Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O43029

Protein Details
Accession O43029    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
379-399LEEPLLKKWRWKKENLEFAALHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, plas 7, E.R. 4, mito 2, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006076  FAD-dep_OxRdtase  
IPR036188  FAD/NAD-bd_sf  
IPR045170  MTOX  
Gene Ontology GO:0005829  C:cytosol  
GO:0005576  C:extracellular region  
GO:0005634  C:nucleus  
GO:0050660  F:flavin adenine dinucleotide binding  
GO:0050031  F:L-pipecolate oxidase activity  
GO:0051699  F:proline oxidase activity  
GO:0008115  F:sarcosine oxidase activity  
GO:0019477  P:L-lysine catabolic process  
KEGG spo:SPBC354.15  -  
Pfam View protein in Pfam  
PF01266  DAO  
Amino Acid Sequences MVKNTSVIIVGAGVFGLSAALELTKRGGYTIKILDRAPPPVIDGSSVDANRIIRSDYADAVYCSMGIDALEEWRTNPLFKEQFYGSGLMFVGRDNVEYRDMSLENLTKMGVSAAKFQTTEELRKLFPKWIGELNDGEAGYANFSSGWANAEQSVKSVVNYLAHAGVSFISGPEGTVEELITEENVVKGVRTTTGAYMAEKLIFATGAWTASLLPNDHTRFLATGQPVAYIKLTPEEYIRFLTNPVYLDFDTGFYIFPPTPDGYLKFARHGYGFTRMQNLKSGKVESVPPKKPLVSPILPKEAELDLRRNLQRTYGEEISQRPFYKTRICYYTDTADAEFVFDYHPDYENLFVCTGGSGHGFKFFPILGKYSIGCMFRELEEPLLKKWRWKKENLEFAALDHSRAGPSRQELS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.05
10 0.08
11 0.09
12 0.09
13 0.1
14 0.13
15 0.14
16 0.2
17 0.28
18 0.31
19 0.34
20 0.34
21 0.4
22 0.41
23 0.44
24 0.39
25 0.31
26 0.29
27 0.28
28 0.28
29 0.23
30 0.2
31 0.19
32 0.23
33 0.23
34 0.21
35 0.21
36 0.21
37 0.2
38 0.2
39 0.18
40 0.13
41 0.17
42 0.19
43 0.18
44 0.19
45 0.2
46 0.19
47 0.19
48 0.18
49 0.14
50 0.12
51 0.1
52 0.08
53 0.06
54 0.06
55 0.05
56 0.08
57 0.09
58 0.09
59 0.1
60 0.14
61 0.15
62 0.15
63 0.16
64 0.23
65 0.25
66 0.26
67 0.3
68 0.26
69 0.29
70 0.3
71 0.3
72 0.21
73 0.19
74 0.18
75 0.14
76 0.13
77 0.1
78 0.11
79 0.09
80 0.11
81 0.1
82 0.12
83 0.14
84 0.14
85 0.15
86 0.16
87 0.16
88 0.16
89 0.18
90 0.18
91 0.16
92 0.16
93 0.15
94 0.11
95 0.11
96 0.11
97 0.1
98 0.09
99 0.16
100 0.17
101 0.19
102 0.19
103 0.19
104 0.25
105 0.25
106 0.29
107 0.26
108 0.26
109 0.26
110 0.29
111 0.31
112 0.29
113 0.29
114 0.27
115 0.26
116 0.3
117 0.33
118 0.31
119 0.31
120 0.28
121 0.27
122 0.24
123 0.21
124 0.15
125 0.12
126 0.1
127 0.09
128 0.07
129 0.04
130 0.05
131 0.05
132 0.05
133 0.07
134 0.06
135 0.07
136 0.09
137 0.11
138 0.1
139 0.1
140 0.13
141 0.12
142 0.12
143 0.13
144 0.12
145 0.12
146 0.12
147 0.12
148 0.1
149 0.1
150 0.09
151 0.08
152 0.07
153 0.06
154 0.06
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.03
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.07
178 0.08
179 0.08
180 0.11
181 0.11
182 0.11
183 0.12
184 0.12
185 0.11
186 0.09
187 0.09
188 0.06
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.06
199 0.06
200 0.07
201 0.12
202 0.14
203 0.14
204 0.14
205 0.14
206 0.13
207 0.14
208 0.17
209 0.12
210 0.13
211 0.13
212 0.14
213 0.14
214 0.14
215 0.13
216 0.09
217 0.09
218 0.1
219 0.1
220 0.09
221 0.11
222 0.12
223 0.13
224 0.14
225 0.15
226 0.12
227 0.13
228 0.13
229 0.14
230 0.13
231 0.12
232 0.14
233 0.13
234 0.14
235 0.13
236 0.13
237 0.11
238 0.11
239 0.1
240 0.07
241 0.09
242 0.08
243 0.08
244 0.1
245 0.1
246 0.12
247 0.13
248 0.15
249 0.17
250 0.23
251 0.24
252 0.24
253 0.24
254 0.24
255 0.23
256 0.22
257 0.21
258 0.23
259 0.25
260 0.23
261 0.3
262 0.3
263 0.31
264 0.37
265 0.36
266 0.32
267 0.32
268 0.33
269 0.25
270 0.26
271 0.31
272 0.33
273 0.41
274 0.42
275 0.42
276 0.43
277 0.44
278 0.44
279 0.43
280 0.41
281 0.38
282 0.41
283 0.43
284 0.48
285 0.46
286 0.44
287 0.42
288 0.36
289 0.35
290 0.31
291 0.29
292 0.24
293 0.32
294 0.34
295 0.34
296 0.32
297 0.32
298 0.33
299 0.33
300 0.37
301 0.33
302 0.33
303 0.33
304 0.37
305 0.36
306 0.38
307 0.35
308 0.31
309 0.31
310 0.33
311 0.39
312 0.4
313 0.42
314 0.41
315 0.45
316 0.45
317 0.47
318 0.48
319 0.42
320 0.39
321 0.33
322 0.29
323 0.24
324 0.21
325 0.16
326 0.12
327 0.1
328 0.08
329 0.1
330 0.1
331 0.12
332 0.11
333 0.12
334 0.15
335 0.16
336 0.18
337 0.16
338 0.14
339 0.13
340 0.12
341 0.11
342 0.1
343 0.11
344 0.1
345 0.1
346 0.16
347 0.16
348 0.15
349 0.18
350 0.17
351 0.19
352 0.2
353 0.22
354 0.19
355 0.22
356 0.22
357 0.23
358 0.28
359 0.25
360 0.23
361 0.22
362 0.22
363 0.21
364 0.24
365 0.22
366 0.22
367 0.27
368 0.28
369 0.31
370 0.38
371 0.37
372 0.43
373 0.51
374 0.57
375 0.59
376 0.66
377 0.73
378 0.75
379 0.85
380 0.81
381 0.78
382 0.67
383 0.61
384 0.61
385 0.5
386 0.4
387 0.3
388 0.26
389 0.21
390 0.23
391 0.24
392 0.21