Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9Y811

Protein Details
Accession Q9Y811    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
117-151SLLARKVQRIVKKKKQREKKSKRKYGNKIDDQDSSHydrophilic
NLS Segment(s)
PositionSequence
121-141RKVQRIVKKKKQREKKSKRKY
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005739  C:mitochondrion  
GO:0004045  F:aminoacyl-tRNA hydrolase activity  
GO:0003747  F:translation release factor activity  
GO:0070126  P:mitochondrial translational termination  
KEGG spo:SPBC1105.18c  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MLCAARKCLNKTFISVRLNAFSCLAELNFRHTWYCSKKETPYQLERLQEEDIEETFICGKGPGGQKINKTSIVAQVKHIPTGIIVRSQDTRSREQNRCIARKRLTEKVDEFKHGNDSLLARKVQRIVKKKKQREKKSKRKYGNKIDDQDSSLNNNEAKQDVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.45
4 0.44
5 0.44
6 0.39
7 0.33
8 0.25
9 0.21
10 0.19
11 0.16
12 0.14
13 0.13
14 0.19
15 0.2
16 0.2
17 0.21
18 0.21
19 0.29
20 0.32
21 0.38
22 0.38
23 0.41
24 0.46
25 0.54
26 0.61
27 0.61
28 0.61
29 0.62
30 0.61
31 0.6
32 0.55
33 0.49
34 0.41
35 0.33
36 0.27
37 0.21
38 0.16
39 0.13
40 0.12
41 0.09
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.11
48 0.14
49 0.18
50 0.22
51 0.26
52 0.29
53 0.34
54 0.36
55 0.32
56 0.29
57 0.26
58 0.3
59 0.32
60 0.29
61 0.26
62 0.3
63 0.29
64 0.29
65 0.27
66 0.19
67 0.14
68 0.16
69 0.14
70 0.1
71 0.1
72 0.11
73 0.13
74 0.15
75 0.19
76 0.2
77 0.24
78 0.3
79 0.38
80 0.41
81 0.44
82 0.5
83 0.53
84 0.58
85 0.59
86 0.59
87 0.56
88 0.61
89 0.61
90 0.63
91 0.58
92 0.56
93 0.55
94 0.56
95 0.53
96 0.49
97 0.45
98 0.37
99 0.39
100 0.33
101 0.28
102 0.21
103 0.2
104 0.21
105 0.23
106 0.24
107 0.2
108 0.22
109 0.27
110 0.31
111 0.38
112 0.44
113 0.51
114 0.61
115 0.71
116 0.79
117 0.84
118 0.9
119 0.92
120 0.93
121 0.94
122 0.95
123 0.95
124 0.95
125 0.96
126 0.95
127 0.95
128 0.95
129 0.94
130 0.93
131 0.89
132 0.82
133 0.75
134 0.68
135 0.6
136 0.51
137 0.44
138 0.37
139 0.33
140 0.29
141 0.27
142 0.25