Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2DC67

Protein Details
Accession A0A0D2DC67    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-63HTATWLERNRKKQRRTRIVGWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGVRDPAFWRRFSMAVHMDEEKGNMSDSRSTSTSSSNGGLKHTATWLERNRKKQRRTRIVGWLIALSFLIVIAAVVLVVLWFLNVGPFKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.33
5 0.31
6 0.29
7 0.27
8 0.27
9 0.2
10 0.15
11 0.14
12 0.11
13 0.11
14 0.14
15 0.15
16 0.18
17 0.17
18 0.18
19 0.18
20 0.2
21 0.2
22 0.17
23 0.18
24 0.17
25 0.16
26 0.16
27 0.16
28 0.14
29 0.13
30 0.12
31 0.13
32 0.11
33 0.17
34 0.23
35 0.33
36 0.38
37 0.48
38 0.58
39 0.65
40 0.73
41 0.76
42 0.8
43 0.8
44 0.83
45 0.8
46 0.79
47 0.75
48 0.68
49 0.61
50 0.51
51 0.39
52 0.32
53 0.24
54 0.14
55 0.08
56 0.05
57 0.04
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.06