Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8WZK1

Protein Details
Accession Q8WZK1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-31LGVRWVHTNRKLQKRKEEHGAFHydrophilic
82-105FYEKPSEKRSRVRSERHRARFRAGBasic
NLS Segment(s)
PositionSequence
87-103SEKRSRVRSERHRARFR
Subcellular Location(s) mito 17.5, mito_nucl 10.833, cyto 4.5, cyto_nucl 4.333, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
IPR038380  S21_sf  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG spo:SPBC839.09c  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MNSSYFPGVLGVRWVHTNRKLQKRKEEHGAFQDSLHFMIPAAETKDLGASVTVGNSLTRAFRQVDRICQRNNVPRLFRSQRFYEKPSEKRSRVRSERHRARFRAGIVRLVNLAKNMRRWGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.33
4 0.42
5 0.48
6 0.58
7 0.66
8 0.7
9 0.78
10 0.8
11 0.8
12 0.82
13 0.78
14 0.73
15 0.72
16 0.69
17 0.59
18 0.5
19 0.46
20 0.35
21 0.3
22 0.23
23 0.15
24 0.09
25 0.1
26 0.1
27 0.09
28 0.1
29 0.1
30 0.09
31 0.1
32 0.1
33 0.09
34 0.08
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.07
47 0.09
48 0.1
49 0.18
50 0.19
51 0.29
52 0.33
53 0.37
54 0.36
55 0.39
56 0.43
57 0.44
58 0.48
59 0.44
60 0.42
61 0.39
62 0.47
63 0.5
64 0.49
65 0.46
66 0.46
67 0.5
68 0.52
69 0.54
70 0.55
71 0.57
72 0.6
73 0.66
74 0.69
75 0.66
76 0.69
77 0.75
78 0.76
79 0.76
80 0.79
81 0.8
82 0.81
83 0.87
84 0.88
85 0.89
86 0.82
87 0.79
88 0.75
89 0.69
90 0.67
91 0.58
92 0.56
93 0.47
94 0.45
95 0.42
96 0.37
97 0.34
98 0.28
99 0.32
100 0.29
101 0.33