Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q10315

Protein Details
Accession Q10315    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
104-128DAPPIKAERKTKRPRARRAANEGEHBasic
NLS Segment(s)
PositionSequence
108-124IKAERKTKRPRARRAAN
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, mito_nucl 12.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0000785  C:chromatin  
GO:0005829  C:cytosol  
GO:0008622  C:epsilon DNA polymerase complex  
GO:0017054  C:negative cofactor 2 complex  
GO:0043596  C:nuclear replication fork  
GO:0005634  C:nucleus  
GO:0001046  F:core promoter sequence-specific DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0016251  F:RNA polymerase II general transcription initiation factor activity  
GO:0006261  P:DNA-templated DNA replication  
GO:0006366  P:transcription by RNA polymerase II  
KEGG spo:SPAC17G8.03c  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MGDPTNNNDSETKPNPATYWKSRFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQTRLHQAKRVTVSHLKHAVQSVEQFDFLQDIVEKVPDAPPIKAERKTKRPRARRAANEGEHNESVPAKKVKKNTVKEEEIEKDDESATTETPVKEEPTGEETEADHEEKASVDHGNFSDKTTSEASSASGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.4
4 0.45
5 0.45
6 0.5
7 0.49
8 0.51
9 0.55
10 0.57
11 0.55
12 0.58
13 0.58
14 0.6
15 0.6
16 0.59
17 0.61
18 0.61
19 0.61
20 0.55
21 0.5
22 0.43
23 0.39
24 0.37
25 0.32
26 0.27
27 0.22
28 0.18
29 0.13
30 0.13
31 0.1
32 0.1
33 0.09
34 0.11
35 0.11
36 0.11
37 0.11
38 0.09
39 0.09
40 0.1
41 0.08
42 0.07
43 0.08
44 0.08
45 0.08
46 0.07
47 0.08
48 0.08
49 0.09
50 0.12
51 0.13
52 0.16
53 0.2
54 0.21
55 0.22
56 0.32
57 0.41
58 0.46
59 0.51
60 0.53
61 0.55
62 0.6
63 0.58
64 0.53
65 0.51
66 0.45
67 0.44
68 0.44
69 0.38
70 0.34
71 0.34
72 0.29
73 0.23
74 0.23
75 0.19
76 0.14
77 0.14
78 0.12
79 0.11
80 0.1
81 0.09
82 0.08
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.09
91 0.11
92 0.1
93 0.13
94 0.19
95 0.23
96 0.29
97 0.36
98 0.4
99 0.5
100 0.6
101 0.68
102 0.73
103 0.79
104 0.83
105 0.85
106 0.88
107 0.85
108 0.84
109 0.83
110 0.76
111 0.74
112 0.66
113 0.6
114 0.5
115 0.42
116 0.33
117 0.25
118 0.22
119 0.2
120 0.23
121 0.23
122 0.27
123 0.33
124 0.43
125 0.52
126 0.59
127 0.64
128 0.67
129 0.66
130 0.65
131 0.65
132 0.59
133 0.53
134 0.47
135 0.37
136 0.29
137 0.25
138 0.23
139 0.19
140 0.15
141 0.12
142 0.12
143 0.15
144 0.14
145 0.15
146 0.17
147 0.16
148 0.16
149 0.16
150 0.17
151 0.19
152 0.21
153 0.2
154 0.19
155 0.18
156 0.2
157 0.22
158 0.2
159 0.15
160 0.13
161 0.13
162 0.13
163 0.13
164 0.11
165 0.11
166 0.1
167 0.14
168 0.14
169 0.2
170 0.2
171 0.22
172 0.24
173 0.22
174 0.25
175 0.24
176 0.24
177 0.2
178 0.2
179 0.19