Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2B0K3

Protein Details
Accession A0A0D2B0K3   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-55PDGTYRRKTQKIKRDLIQKAKVKHydrophilic
120-146DDQQHSSRSQPRQRRQKQSRFKKELELHydrophilic
NLS Segment(s)
PositionSequence
38-57RRKTQKIKRDLIQKAKVKKA
131-186RQRRQKQSRFKKELELASQHKANIEAKQKARELRDKERRAMVKAKRPGKDGKIKVG
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSVKRSSSDRPVGADEPDSKKRKGFSVGPANLPDGTYRRKTQKIKRDLIQKAKVKKAYAKVKAQEEATHPSSSAQFADQDAHAAPVDVEPASLELHPDRQAMVDAADSRDLERSQKDFRDDQQHSSRSQPRQRRQKQSRFKKELELASQHKANIEAKQKARELRDKERRAMVKAKRPGKDGKIKVGRQGTVLLNRIQRMTAEGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.4
4 0.47
5 0.48
6 0.44
7 0.45
8 0.46
9 0.46
10 0.47
11 0.46
12 0.46
13 0.53
14 0.56
15 0.57
16 0.56
17 0.52
18 0.45
19 0.39
20 0.31
21 0.24
22 0.26
23 0.26
24 0.31
25 0.37
26 0.45
27 0.55
28 0.62
29 0.69
30 0.73
31 0.76
32 0.78
33 0.8
34 0.81
35 0.81
36 0.81
37 0.78
38 0.75
39 0.75
40 0.73
41 0.66
42 0.63
43 0.63
44 0.63
45 0.64
46 0.64
47 0.62
48 0.62
49 0.62
50 0.56
51 0.5
52 0.43
53 0.42
54 0.37
55 0.31
56 0.26
57 0.24
58 0.23
59 0.21
60 0.17
61 0.11
62 0.09
63 0.09
64 0.11
65 0.1
66 0.1
67 0.09
68 0.1
69 0.09
70 0.08
71 0.07
72 0.06
73 0.07
74 0.05
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.08
83 0.09
84 0.09
85 0.08
86 0.08
87 0.09
88 0.08
89 0.08
90 0.07
91 0.06
92 0.07
93 0.08
94 0.07
95 0.07
96 0.09
97 0.09
98 0.1
99 0.11
100 0.14
101 0.17
102 0.2
103 0.23
104 0.24
105 0.28
106 0.36
107 0.36
108 0.4
109 0.44
110 0.44
111 0.42
112 0.47
113 0.5
114 0.48
115 0.55
116 0.59
117 0.6
118 0.7
119 0.78
120 0.82
121 0.86
122 0.88
123 0.9
124 0.91
125 0.93
126 0.9
127 0.83
128 0.8
129 0.75
130 0.7
131 0.65
132 0.61
133 0.54
134 0.5
135 0.49
136 0.41
137 0.35
138 0.32
139 0.28
140 0.27
141 0.31
142 0.35
143 0.37
144 0.42
145 0.46
146 0.49
147 0.53
148 0.55
149 0.55
150 0.59
151 0.66
152 0.66
153 0.67
154 0.71
155 0.68
156 0.65
157 0.66
158 0.64
159 0.64
160 0.67
161 0.7
162 0.66
163 0.66
164 0.69
165 0.69
166 0.71
167 0.66
168 0.68
169 0.7
170 0.68
171 0.71
172 0.7
173 0.61
174 0.52
175 0.52
176 0.46
177 0.43
178 0.44
179 0.41
180 0.39
181 0.39
182 0.39
183 0.34
184 0.29
185 0.26