Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2DKV4

Protein Details
Accession A0A0D2DKV4   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-100HAAKGDRESKRSRRRHPCRTTRKARGFTRRRRRRRAEBasic
NLS Segment(s)
PositionSequence
61-100RAYHAAKGDRESKRSRRRHPCRTTRKARGFTRRRRRRRAE
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
Amino Acid Sequences MASDDEFEPDSRQRNYRAPYTARHPIPTVQKYKAERSELKGQQEEAESAQHDDEDDSKVKRAYHAAKGDRESKRSRRRHPCRTTRKARGFTRRRRRRRAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.47
4 0.51
5 0.49
6 0.5
7 0.54
8 0.58
9 0.52
10 0.5
11 0.46
12 0.44
13 0.5
14 0.52
15 0.5
16 0.44
17 0.49
18 0.5
19 0.55
20 0.56
21 0.53
22 0.49
23 0.49
24 0.56
25 0.53
26 0.54
27 0.48
28 0.42
29 0.37
30 0.34
31 0.29
32 0.19
33 0.16
34 0.11
35 0.1
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.08
42 0.1
43 0.1
44 0.12
45 0.14
46 0.14
47 0.15
48 0.21
49 0.23
50 0.3
51 0.37
52 0.41
53 0.44
54 0.48
55 0.55
56 0.53
57 0.53
58 0.53
59 0.56
60 0.61
61 0.66
62 0.73
63 0.76
64 0.82
65 0.88
66 0.91
67 0.92
68 0.92
69 0.93
70 0.94
71 0.93
72 0.93
73 0.92
74 0.91
75 0.91
76 0.9
77 0.91
78 0.91
79 0.91
80 0.92