FuNGI

O59755

Protein Details

Accession

O59755

Localization Confidence

Medium

Confidence Score

13.5

NoLS Segment(s)

Position	Sequence	Protein Nature
517-548	KSPNQRTANAKKRLEERRRRRKLKLQELQLNS	Hydrophilic

NLS Segment(s)

Position	Sequence
526-540	AKKRLEERRRRRKLK

Subcellular Location(s)

nucl 20.5, cyto_nucl 13, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR021589 Cut12
Gene Ontology	GO:0005737 C:cytoplasm GO:0061497 C:inner plaque of mitotic spindle pole body GO:0035974 C:meiotic spindle pole body GO:0015630 C:microtubule cytoskeleton GO:0044732 C:mitotic spindle pole body GO:0005634 C:nucleus GO:0030295 F:protein kinase activator activity GO:0035591 F:signaling adaptor activity GO:0051301 P:cell division GO:0000086 P:G2/M transition of mitotic cell cycle GO:0140480 P:mitotic spindle pole body insertion into the nuclear envelope GO:0010972 P:negative regulation of G2/M transition of mitotic cell cycle GO:0110161 P:positive regulation of mitotic spindle formation (spindle phase one)
KEGG	spo:SPBC649.05 -
Pfam	View protein in Pfam PF11500 Cut12

Amino Acid Sequences

MSETLNTPPTYAWVLKAFSSKLAGTVTKPVTKMSSYIEDAESDAELPQDAKEDLRPTETLTPLKSKAAQNGILKTPGTLQIKKTVNFKDISKDAATWNRPTKNNFLFTRLDDENPLMGHEEFKSPLLQSTPKPNINNPDNENKSKHDEFDNRYNININESYKNETKSNQRLGEDVPSKKKYPHSMDAEISKFKWDSNNNNDWSSLMKDCFRDVVNNNRKMKEIIKDVMIDTSQAFPSESLDEPDYTINLDAPRSSSGKYWKQKFSMLDSAHSDLELELTSIRERLESLILEKQEEINFWKQRCRALETEKIHNHQGQQSKYKGKEFVGNRFSQMRELYTAKPSPITTKVVSRPSQSDVREPQEQVPSKNLHRGADMSHLAAQMLTHSSKKSHTTNLIPSEGIISSTPISAASKVRMNLMQSNQTPTPAPFSIAAKKSHLPSKLSFPQDGGSLSSATTLQQLPKARVTPNVLSSLSSNLGKTNPTSVYQSKANVTTSADVEKPQVKVATSSRVDYDLKSPNQRTANAKKRLEERRRRRKLKLQELQLNS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.24
2	0.26
3	0.31
4	0.29
5	0.26
6	0.29
7	0.25
8	0.23
9	0.25
10	0.25
11	0.22
12	0.3
13	0.33
14	0.34
15	0.35
16	0.34
17	0.34
18	0.33
19	0.33
20	0.3
21	0.31
22	0.3
23	0.32
24	0.31
25	0.28
26	0.27
27	0.26
28	0.21
29	0.15
30	0.12
31	0.09
32	0.09
33	0.09
34	0.08
35	0.1
36	0.1
37	0.11
38	0.15
39	0.18
40	0.2
41	0.23
42	0.23
43	0.25
44	0.31
45	0.34
46	0.34
47	0.33
48	0.37
49	0.36
50	0.39
51	0.41
52	0.38
53	0.41
54	0.44
55	0.48
56	0.48
57	0.51
58	0.5
59	0.47
60	0.43
61	0.36
62	0.32
63	0.33
64	0.34
65	0.32
66	0.31
67	0.37
68	0.43
69	0.46
70	0.51
71	0.48
72	0.46
73	0.46
74	0.45
75	0.44
76	0.4
77	0.42
78	0.35
79	0.32
80	0.33
81	0.39
82	0.41
83	0.4
84	0.47
85	0.49
86	0.52
87	0.55
88	0.59
89	0.57
90	0.62
91	0.56
92	0.53
93	0.49
94	0.47
95	0.49
96	0.41
97	0.35
98	0.29
99	0.28
100	0.24
101	0.21
102	0.2
103	0.15
104	0.13
105	0.14
106	0.13
107	0.14
108	0.14
109	0.15
110	0.15
111	0.13
112	0.15
113	0.17
114	0.2
115	0.21
116	0.3
117	0.37
118	0.42
119	0.44
120	0.46
121	0.52
122	0.54
123	0.58
124	0.52
125	0.55
126	0.55
127	0.57
128	0.56
129	0.5
130	0.52
131	0.47
132	0.45
133	0.42
134	0.44
135	0.46
136	0.53
137	0.56
138	0.49
139	0.48
140	0.49
141	0.41
142	0.37
143	0.34
144	0.27
145	0.24
146	0.25
147	0.31
148	0.31
149	0.34
150	0.31
151	0.32
152	0.37
153	0.42
154	0.48
155	0.46
156	0.44
157	0.42
158	0.43
159	0.47
160	0.45
161	0.42
162	0.42
163	0.42
164	0.43
165	0.45
166	0.49
167	0.49
168	0.5
169	0.53
170	0.52
171	0.53
172	0.55
173	0.57
174	0.54
175	0.47
176	0.39
177	0.33
178	0.26
179	0.22
180	0.25
181	0.25
182	0.3
183	0.37
184	0.45
185	0.45
186	0.46
187	0.45
188	0.39
189	0.35
190	0.29
191	0.23
192	0.16
193	0.16
194	0.16
195	0.16
196	0.18
197	0.17
198	0.19
199	0.2
200	0.3
201	0.37
202	0.45
203	0.48
204	0.47
205	0.48
206	0.45
207	0.45
208	0.4
209	0.36
210	0.3
211	0.28
212	0.28
213	0.27
214	0.26
215	0.22
216	0.17
217	0.12
218	0.11
219	0.09
220	0.08
221	0.08
222	0.07
223	0.09
224	0.1
225	0.1
226	0.1
227	0.11
228	0.11
229	0.11
230	0.12
231	0.1
232	0.08
233	0.08
234	0.08
235	0.07
236	0.07
237	0.06
238	0.07
239	0.1
240	0.1
241	0.11
242	0.13
243	0.2
244	0.29
245	0.36
246	0.42
247	0.45
248	0.46
249	0.5
250	0.49
251	0.47
252	0.47
253	0.4
254	0.35
255	0.33
256	0.33
257	0.28
258	0.26
259	0.19
260	0.11
261	0.11
262	0.08
263	0.06
264	0.04
265	0.05
266	0.05
267	0.06
268	0.06
269	0.05
270	0.05
271	0.06
272	0.08
273	0.07
274	0.1
275	0.12
276	0.13
277	0.13
278	0.13
279	0.14
280	0.12
281	0.13
282	0.14
283	0.19
284	0.23
285	0.23
286	0.28
287	0.28
288	0.33
289	0.35
290	0.36
291	0.34
292	0.36
293	0.44
294	0.43
295	0.5
296	0.49
297	0.49
298	0.47
299	0.43
300	0.39
301	0.36
302	0.38
303	0.33
304	0.35
305	0.39
306	0.43
307	0.44
308	0.45
309	0.42
310	0.37
311	0.41
312	0.38
313	0.42
314	0.41
315	0.39
316	0.38
317	0.38
318	0.37
319	0.32
320	0.29
321	0.21
322	0.19
323	0.21
324	0.21
325	0.24
326	0.25
327	0.22
328	0.23
329	0.22
330	0.23
331	0.23
332	0.25
333	0.21
334	0.27
335	0.32
336	0.37
337	0.39
338	0.38
339	0.37
340	0.37
341	0.42
342	0.38
343	0.39
344	0.37
345	0.4
346	0.41
347	0.4
348	0.4
349	0.42
350	0.43
351	0.37
352	0.37
353	0.37
354	0.35
355	0.4
356	0.38
357	0.31
358	0.29
359	0.29
360	0.26
361	0.27
362	0.26
363	0.21
364	0.2
365	0.19
366	0.17
367	0.16
368	0.14
369	0.09
370	0.1
371	0.11
372	0.1
373	0.11
374	0.13
375	0.16
376	0.22
377	0.24
378	0.28
379	0.32
380	0.37
381	0.44
382	0.47
383	0.46
384	0.4
385	0.37
386	0.33
387	0.27
388	0.22
389	0.14
390	0.1
391	0.09
392	0.09
393	0.09
394	0.08
395	0.09
396	0.1
397	0.12
398	0.13
399	0.17
400	0.17
401	0.2
402	0.22
403	0.24
404	0.28
405	0.3
406	0.35
407	0.33
408	0.38
409	0.36
410	0.35
411	0.33
412	0.28
413	0.3
414	0.22
415	0.23
416	0.19
417	0.22
418	0.29
419	0.32
420	0.34
421	0.32
422	0.35
423	0.38
424	0.42
425	0.42
426	0.38
427	0.37
428	0.44
429	0.48
430	0.49
431	0.45
432	0.4
433	0.37
434	0.34
435	0.33
436	0.25
437	0.18
438	0.14
439	0.13
440	0.13
441	0.12
442	0.1
443	0.12
444	0.12
445	0.13
446	0.18
447	0.22
448	0.25
449	0.3
450	0.34
451	0.33
452	0.37
453	0.42
454	0.41
455	0.41
456	0.43
457	0.37
458	0.35
459	0.34
460	0.31
461	0.28
462	0.24
463	0.2
464	0.17
465	0.18
466	0.19
467	0.19
468	0.21
469	0.2
470	0.21
471	0.27
472	0.28
473	0.31
474	0.34
475	0.36
476	0.35
477	0.36
478	0.35
479	0.3
480	0.31
481	0.29
482	0.27
483	0.27
484	0.24
485	0.22
486	0.25
487	0.27
488	0.26
489	0.27
490	0.27
491	0.24
492	0.28
493	0.31
494	0.36
495	0.34
496	0.35
497	0.33
498	0.36
499	0.36
500	0.33
501	0.36
502	0.35
503	0.4
504	0.47
505	0.48
506	0.51
507	0.55
508	0.58
509	0.6
510	0.62
511	0.66
512	0.67
513	0.69
514	0.68
515	0.73
516	0.78
517	0.81
518	0.81
519	0.82
520	0.83
521	0.9
522	0.92
523	0.93
524	0.92
525	0.92
526	0.92
527	0.91
528	0.9

O59755

3D AlphaFold-predicted Structure Viewer