Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2TRN0

Protein Details
Accession G2TRN0   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-28KRCRSEHVPSRLPRKKCKNHLDMRSFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, mito_nucl 12.666, mito 3.5
Family & Domain DBs
Amino Acid Sequences MKRCRSEHVPSRLPRKKCKNHLDMRSFLSLFASKKSNAHDASSIVLNEKVNFVTDNDHLPSSTGVCEFCDNVLYLSTCDRCQRNICRNCSTLMYFKENTVARCLDCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.83
5 0.86
6 0.85
7 0.87
8 0.9
9 0.87
10 0.8
11 0.73
12 0.68
13 0.57
14 0.47
15 0.39
16 0.32
17 0.26
18 0.24
19 0.22
20 0.17
21 0.2
22 0.23
23 0.27
24 0.25
25 0.26
26 0.25
27 0.23
28 0.23
29 0.22
30 0.19
31 0.13
32 0.13
33 0.12
34 0.1
35 0.1
36 0.09
37 0.08
38 0.08
39 0.08
40 0.09
41 0.1
42 0.11
43 0.12
44 0.12
45 0.11
46 0.11
47 0.11
48 0.09
49 0.09
50 0.08
51 0.07
52 0.08
53 0.09
54 0.08
55 0.08
56 0.09
57 0.08
58 0.08
59 0.09
60 0.09
61 0.09
62 0.12
63 0.13
64 0.14
65 0.19
66 0.2
67 0.23
68 0.3
69 0.39
70 0.47
71 0.54
72 0.59
73 0.61
74 0.6
75 0.59
76 0.56
77 0.5
78 0.46
79 0.43
80 0.43
81 0.37
82 0.36
83 0.41
84 0.39
85 0.37
86 0.35
87 0.32