Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2C655

Protein Details
Accession A0A0D2C655    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
281-309FEVYPPKESYERRRRRRRRPKDTAGGGGGBasic
NLS Segment(s)
PositionSequence
292-301RRRRRRRRPK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007325  KFase/CYL  
IPR037175  KFase_sf  
Gene Ontology GO:0004061  F:arylformamidase activity  
GO:0019441  P:tryptophan catabolic process to kynurenine  
Pfam View protein in Pfam  
PF04199  Cyclase  
Amino Acid Sequences MASSDNHDFETVEIHPEHLLPFDSLPDKKRVWPGEPGSREEGLGRLVLLTPEVVASAASTCVRTGRRVSLGWELTKLEIANFGRSPCRHEIVELLDGVAFDDIYTFNPQQSSQWDGLRHFSQPLRRNLDDEVGKTGAGTGSEERLFYGGVTKSEIKDPWCRRIGIHEWAKQGICGRGVLLDFVRYADRKGLEYSTFGDFAISLSVLLEIATEQRVEFKRGDILFVRIGVTREWDTRMTATQKQEYAESQNPRHSGVQGTEEMLRWLWDTGFSAVASDAISFEVYPPKESYERRRRRRRRPKDTAGGGGGGGEEEEDGDDESQVEKIPGIFLHEYLLSGWGMPIGELFDLEDLSKLCSSHNRWEFFVSSSPFNMPGGVSSPPNCIAIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.15
6 0.16
7 0.13
8 0.13
9 0.16
10 0.21
11 0.24
12 0.27
13 0.32
14 0.33
15 0.38
16 0.46
17 0.48
18 0.47
19 0.53
20 0.57
21 0.61
22 0.63
23 0.62
24 0.58
25 0.53
26 0.49
27 0.4
28 0.33
29 0.24
30 0.2
31 0.15
32 0.1
33 0.1
34 0.1
35 0.09
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.07
45 0.08
46 0.08
47 0.08
48 0.13
49 0.15
50 0.18
51 0.22
52 0.26
53 0.3
54 0.31
55 0.34
56 0.39
57 0.41
58 0.39
59 0.37
60 0.32
61 0.28
62 0.29
63 0.25
64 0.16
65 0.18
66 0.18
67 0.2
68 0.21
69 0.22
70 0.26
71 0.27
72 0.33
73 0.31
74 0.34
75 0.29
76 0.29
77 0.31
78 0.29
79 0.31
80 0.25
81 0.2
82 0.17
83 0.16
84 0.15
85 0.12
86 0.07
87 0.04
88 0.05
89 0.05
90 0.06
91 0.11
92 0.11
93 0.12
94 0.13
95 0.13
96 0.15
97 0.17
98 0.21
99 0.19
100 0.23
101 0.24
102 0.25
103 0.29
104 0.29
105 0.27
106 0.25
107 0.26
108 0.31
109 0.36
110 0.44
111 0.47
112 0.46
113 0.47
114 0.45
115 0.48
116 0.42
117 0.35
118 0.31
119 0.23
120 0.22
121 0.2
122 0.19
123 0.13
124 0.1
125 0.1
126 0.07
127 0.09
128 0.1
129 0.1
130 0.1
131 0.1
132 0.09
133 0.08
134 0.12
135 0.1
136 0.1
137 0.13
138 0.15
139 0.15
140 0.18
141 0.2
142 0.18
143 0.27
144 0.31
145 0.36
146 0.38
147 0.37
148 0.35
149 0.4
150 0.42
151 0.42
152 0.46
153 0.42
154 0.41
155 0.42
156 0.42
157 0.35
158 0.32
159 0.25
160 0.17
161 0.13
162 0.11
163 0.1
164 0.1
165 0.1
166 0.08
167 0.07
168 0.07
169 0.07
170 0.09
171 0.08
172 0.08
173 0.1
174 0.11
175 0.11
176 0.13
177 0.14
178 0.13
179 0.14
180 0.15
181 0.14
182 0.14
183 0.12
184 0.11
185 0.09
186 0.08
187 0.08
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.04
197 0.04
198 0.04
199 0.04
200 0.1
201 0.11
202 0.14
203 0.14
204 0.14
205 0.2
206 0.2
207 0.23
208 0.18
209 0.2
210 0.18
211 0.18
212 0.18
213 0.13
214 0.14
215 0.12
216 0.13
217 0.13
218 0.14
219 0.15
220 0.15
221 0.15
222 0.15
223 0.19
224 0.21
225 0.24
226 0.27
227 0.28
228 0.29
229 0.29
230 0.29
231 0.27
232 0.29
233 0.3
234 0.32
235 0.32
236 0.35
237 0.35
238 0.36
239 0.36
240 0.3
241 0.26
242 0.22
243 0.23
244 0.19
245 0.2
246 0.18
247 0.17
248 0.17
249 0.14
250 0.13
251 0.09
252 0.09
253 0.08
254 0.07
255 0.09
256 0.09
257 0.1
258 0.09
259 0.09
260 0.08
261 0.09
262 0.08
263 0.06
264 0.06
265 0.05
266 0.05
267 0.05
268 0.06
269 0.12
270 0.12
271 0.15
272 0.15
273 0.18
274 0.24
275 0.29
276 0.39
277 0.45
278 0.55
279 0.64
280 0.75
281 0.82
282 0.88
283 0.95
284 0.95
285 0.95
286 0.95
287 0.95
288 0.94
289 0.9
290 0.85
291 0.76
292 0.65
293 0.53
294 0.42
295 0.31
296 0.2
297 0.13
298 0.07
299 0.04
300 0.03
301 0.04
302 0.04
303 0.05
304 0.05
305 0.06
306 0.06
307 0.07
308 0.07
309 0.08
310 0.07
311 0.07
312 0.07
313 0.08
314 0.08
315 0.13
316 0.13
317 0.13
318 0.15
319 0.15
320 0.15
321 0.14
322 0.15
323 0.1
324 0.09
325 0.09
326 0.08
327 0.07
328 0.07
329 0.07
330 0.06
331 0.06
332 0.06
333 0.07
334 0.06
335 0.07
336 0.07
337 0.08
338 0.08
339 0.11
340 0.12
341 0.12
342 0.13
343 0.21
344 0.27
345 0.36
346 0.43
347 0.44
348 0.45
349 0.49
350 0.49
351 0.44
352 0.46
353 0.39
354 0.33
355 0.32
356 0.32
357 0.29
358 0.28
359 0.25
360 0.18
361 0.16
362 0.16
363 0.16
364 0.18
365 0.18
366 0.22
367 0.23