Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UU87

Protein Details
Accession Q9UU87    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-89YAIKEFKKTSLRRREKFRLMQLEKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0071277  P:cellular response to calcium ion  
GO:0106057  P:negative regulation of calcineurin-mediated signaling  
GO:1904262  P:negative regulation of TORC1 signaling  
GO:0006468  P:protein phosphorylation  
GO:0007165  P:signal transduction  
KEGG spo:SPCC1919.01  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd14008  STKc_LKB1_CaMKK  
Amino Acid Sequences MSLPLPSFLSSNNYNSSETSLLTEGPESDEEDEGPLLKQYRLKNMLGYGACSTVYLAVDVSTNIEYAIKEFKKTSLRRREKFRLMQLEKELGSFNDMDSSTIEDQIRNQEKKDPYYYIRKELDVLKVLDHENVVKLYQVINSDYKDSLCMVLNYCPGGKLASVDHGISFDPMPLETCRKSFRQLVLAVNYIHGKGVIHRDIKPDNILFKENNNLCVIDFGLAEFLPKDGFVKPASGTPAFMAPELFDNELKKIKGKPLDIWSMGVTLYVIAFAEFPFNGSTILDMINVIKGKSLMIPAYCNSDLRKLLERCLEKNPEKRITIEELLRDPFLTERGKHHLTSSSIVTAFSSIWEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.33
4 0.28
5 0.25
6 0.24
7 0.2
8 0.18
9 0.17
10 0.17
11 0.13
12 0.15
13 0.15
14 0.14
15 0.15
16 0.15
17 0.14
18 0.15
19 0.14
20 0.12
21 0.12
22 0.13
23 0.14
24 0.15
25 0.21
26 0.23
27 0.33
28 0.38
29 0.38
30 0.39
31 0.39
32 0.44
33 0.39
34 0.38
35 0.29
36 0.25
37 0.23
38 0.2
39 0.18
40 0.12
41 0.12
42 0.09
43 0.08
44 0.07
45 0.08
46 0.08
47 0.09
48 0.08
49 0.08
50 0.07
51 0.08
52 0.08
53 0.09
54 0.18
55 0.17
56 0.19
57 0.2
58 0.26
59 0.35
60 0.42
61 0.51
62 0.54
63 0.64
64 0.69
65 0.78
66 0.82
67 0.83
68 0.84
69 0.83
70 0.83
71 0.76
72 0.75
73 0.7
74 0.64
75 0.54
76 0.46
77 0.38
78 0.26
79 0.24
80 0.18
81 0.13
82 0.13
83 0.12
84 0.12
85 0.12
86 0.16
87 0.14
88 0.18
89 0.18
90 0.15
91 0.16
92 0.25
93 0.33
94 0.3
95 0.3
96 0.35
97 0.39
98 0.43
99 0.46
100 0.42
101 0.38
102 0.48
103 0.5
104 0.5
105 0.48
106 0.44
107 0.42
108 0.4
109 0.4
110 0.34
111 0.31
112 0.23
113 0.23
114 0.23
115 0.21
116 0.18
117 0.14
118 0.11
119 0.11
120 0.1
121 0.08
122 0.08
123 0.08
124 0.09
125 0.1
126 0.11
127 0.13
128 0.14
129 0.15
130 0.15
131 0.15
132 0.14
133 0.13
134 0.12
135 0.1
136 0.1
137 0.1
138 0.12
139 0.12
140 0.12
141 0.12
142 0.11
143 0.1
144 0.09
145 0.08
146 0.07
147 0.07
148 0.09
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.09
155 0.09
156 0.06
157 0.05
158 0.05
159 0.07
160 0.08
161 0.11
162 0.11
163 0.13
164 0.16
165 0.17
166 0.2
167 0.23
168 0.24
169 0.27
170 0.29
171 0.3
172 0.3
173 0.31
174 0.27
175 0.24
176 0.22
177 0.16
178 0.13
179 0.1
180 0.07
181 0.07
182 0.13
183 0.17
184 0.19
185 0.2
186 0.24
187 0.26
188 0.27
189 0.28
190 0.24
191 0.22
192 0.21
193 0.23
194 0.19
195 0.19
196 0.26
197 0.24
198 0.25
199 0.23
200 0.21
201 0.18
202 0.18
203 0.17
204 0.09
205 0.08
206 0.06
207 0.06
208 0.06
209 0.06
210 0.05
211 0.05
212 0.04
213 0.04
214 0.06
215 0.06
216 0.08
217 0.09
218 0.1
219 0.11
220 0.13
221 0.17
222 0.16
223 0.16
224 0.15
225 0.17
226 0.16
227 0.15
228 0.13
229 0.09
230 0.11
231 0.12
232 0.13
233 0.12
234 0.12
235 0.15
236 0.19
237 0.19
238 0.2
239 0.21
240 0.27
241 0.32
242 0.34
243 0.38
244 0.4
245 0.47
246 0.44
247 0.43
248 0.37
249 0.31
250 0.27
251 0.21
252 0.14
253 0.07
254 0.06
255 0.05
256 0.04
257 0.04
258 0.04
259 0.04
260 0.06
261 0.06
262 0.07
263 0.07
264 0.08
265 0.08
266 0.08
267 0.08
268 0.08
269 0.08
270 0.07
271 0.07
272 0.07
273 0.1
274 0.11
275 0.1
276 0.1
277 0.1
278 0.11
279 0.12
280 0.14
281 0.13
282 0.14
283 0.17
284 0.17
285 0.24
286 0.24
287 0.24
288 0.24
289 0.27
290 0.29
291 0.3
292 0.39
293 0.33
294 0.38
295 0.45
296 0.48
297 0.46
298 0.52
299 0.58
300 0.57
301 0.63
302 0.66
303 0.65
304 0.62
305 0.61
306 0.57
307 0.55
308 0.53
309 0.49
310 0.45
311 0.41
312 0.42
313 0.4
314 0.35
315 0.28
316 0.23
317 0.24
318 0.24
319 0.23
320 0.26
321 0.34
322 0.37
323 0.37
324 0.39
325 0.41
326 0.39
327 0.4
328 0.38
329 0.35
330 0.32
331 0.31
332 0.28
333 0.23
334 0.19