Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9C0Z3

Protein Details
Accession Q9C0Z3   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-95NNDPLKETKKDKRKDRHFNWQQKFSNPKISASARKRRNRKARENLKVNVHydrophilic
NLS Segment(s)
PositionSequence
55-88KKDKRKDRHFNWQQKFSNPKISASARKRRNRKAR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0030515  F:snoRNA binding  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG spo:SPAPB21F2.03  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MPKAKKRVSLASKASSRLPSSGKPSQQASIPNVELSSTVTSNSQVLNNDPLKETKKDKRKDRHFNWQQKFSNPKISASARKRRNRKARENLKVNVSSIGEVLPEIDLDISVANSRLKPVIKDSLSSKQTKSSMKRNTVEEIERFQAILKHPSFVSNPLETVREHLGNSLDSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.56
3 0.5
4 0.45
5 0.42
6 0.38
7 0.41
8 0.47
9 0.46
10 0.46
11 0.47
12 0.44
13 0.44
14 0.44
15 0.4
16 0.38
17 0.34
18 0.3
19 0.27
20 0.25
21 0.22
22 0.19
23 0.18
24 0.12
25 0.11
26 0.11
27 0.12
28 0.13
29 0.14
30 0.13
31 0.11
32 0.13
33 0.2
34 0.21
35 0.21
36 0.22
37 0.24
38 0.26
39 0.29
40 0.35
41 0.37
42 0.45
43 0.53
44 0.62
45 0.69
46 0.76
47 0.83
48 0.83
49 0.85
50 0.86
51 0.88
52 0.85
53 0.84
54 0.76
55 0.72
56 0.71
57 0.62
58 0.62
59 0.52
60 0.45
61 0.4
62 0.42
63 0.44
64 0.46
65 0.53
66 0.53
67 0.6
68 0.68
69 0.73
70 0.8
71 0.8
72 0.82
73 0.84
74 0.85
75 0.87
76 0.85
77 0.77
78 0.72
79 0.64
80 0.53
81 0.44
82 0.34
83 0.24
84 0.17
85 0.14
86 0.08
87 0.07
88 0.06
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.06
100 0.06
101 0.07
102 0.1
103 0.11
104 0.12
105 0.17
106 0.24
107 0.24
108 0.26
109 0.3
110 0.36
111 0.4
112 0.42
113 0.38
114 0.36
115 0.41
116 0.47
117 0.48
118 0.49
119 0.54
120 0.6
121 0.64
122 0.61
123 0.61
124 0.58
125 0.57
126 0.5
127 0.45
128 0.39
129 0.34
130 0.31
131 0.26
132 0.25
133 0.23
134 0.28
135 0.24
136 0.25
137 0.25
138 0.28
139 0.29
140 0.29
141 0.32
142 0.25
143 0.26
144 0.25
145 0.27
146 0.23
147 0.26
148 0.26
149 0.23
150 0.21
151 0.22
152 0.23