FuNGI

Q10144

Protein Details

Accession

Q10144

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
1-47	MSSSPPALKKFRKRSPKSCLICRRRKVKCDRQQPCSRCKERNEVCTY	Hydrophilic

NLS Segment(s)

Position	Sequence
12-13	RK

Subcellular Location(s)

nucl 19, plas 3, cyto_mito 2, mito 1.5, cyto 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005829 C:cytosol GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0045944 P:positive regulation of transcription by RNA polymerase II
KEGG	spo:SPAC3H8.08c -
Pfam	View protein in Pfam PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd12148 fungal_TF_MHR cd00067 GAL4

Amino Acid Sequences

MSSSPPALKKFRKRSPKSCLICRRRKVKCDRQQPCSRCKERNEVCTYADDTIDKMNVGPHPSHSENASDSETTLEVSPDINPKKNEKFDFYGWRSLFELIKYRKDSDMCSSRPSFSIQAYSSYKDNVVVESLANLLPPFCISQKIVNLFFKTLNVVCPIYDQETVEKSLNNIESPESFSYEDAFTLLPIIAATIQLSDLPDVILNFYNSAGITPLESSRLINLKLNEISEQEYKHLCLPDKEIIQMLLLRAYATKFRTRIRGVNTDLCRSIHVSTLVTPLFQVTEKIGKNTSDLWFALCEIDGLECVLKYRPPFIQHDTYGRLKPLRCFFNDDISYNFHLLLGRLLDCGVSIYKSVHSLTVSKFIDKLESYESQLSLILVDIEAKFYDPSNEDIQFRYIFLKMVFWTARVNLYQCFITLDSGILEDEETIIGNLGESCIQCVRLLISQITILEKRGWLLVALLEIIHALMLAAFCRDKGFEVPSDLGDITLYVQERMVDIVTFDDGMAVRFGYVLRFINSMLHPNEPPMQDAEPETTEDPSKLFADIFDFTSNYFIPSALLDQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.89
2	0.9
3	0.91
4	0.89
5	0.89
6	0.9
7	0.89
8	0.9
9	0.89
10	0.89
11	0.88
12	0.9
13	0.9
14	0.9
15	0.9
16	0.9
17	0.9
18	0.9
19	0.91
20	0.88
21	0.87
22	0.87
23	0.85
24	0.82
25	0.8
26	0.81
27	0.78
28	0.81
29	0.78
30	0.71
31	0.64
32	0.6
33	0.56
34	0.46
35	0.39
36	0.29
37	0.23
38	0.22
39	0.2
40	0.16
41	0.13
42	0.16
43	0.18
44	0.21
45	0.21
46	0.22
47	0.29
48	0.31
49	0.32
50	0.29
51	0.29
52	0.27
53	0.3
54	0.29
55	0.21
56	0.19
57	0.19
58	0.18
59	0.16
60	0.15
61	0.12
62	0.09
63	0.1
64	0.12
65	0.19
66	0.24
67	0.29
68	0.32
69	0.39
70	0.47
71	0.55
72	0.57
73	0.55
74	0.57
75	0.57
76	0.65
77	0.62
78	0.62
79	0.54
80	0.52
81	0.46
82	0.43
83	0.37
84	0.29
85	0.35
86	0.3
87	0.38
88	0.39
89	0.4
90	0.43
91	0.43
92	0.44
93	0.44
94	0.48
95	0.42
96	0.45
97	0.45
98	0.42
99	0.41
100	0.41
101	0.34
102	0.27
103	0.31
104	0.25
105	0.29
106	0.3
107	0.31
108	0.29
109	0.28
110	0.26
111	0.23
112	0.22
113	0.16
114	0.15
115	0.13
116	0.12
117	0.11
118	0.12
119	0.09
120	0.09
121	0.08
122	0.07
123	0.06
124	0.07
125	0.08
126	0.07
127	0.1
128	0.12
129	0.17
130	0.22
131	0.27
132	0.31
133	0.33
134	0.35
135	0.33
136	0.32
137	0.28
138	0.26
139	0.22
140	0.19
141	0.18
142	0.16
143	0.15
144	0.16
145	0.17
146	0.17
147	0.17
148	0.16
149	0.16
150	0.17
151	0.2
152	0.19
153	0.17
154	0.15
155	0.19
156	0.19
157	0.17
158	0.16
159	0.14
160	0.14
161	0.18
162	0.18
163	0.16
164	0.15
165	0.15
166	0.16
167	0.15
168	0.14
169	0.11
170	0.1
171	0.07
172	0.07
173	0.07
174	0.05
175	0.05
176	0.05
177	0.04
178	0.04
179	0.04
180	0.04
181	0.04
182	0.04
183	0.05
184	0.05
185	0.05
186	0.05
187	0.05
188	0.05
189	0.07
190	0.07
191	0.07
192	0.07
193	0.07
194	0.08
195	0.07
196	0.07
197	0.06
198	0.05
199	0.06
200	0.06
201	0.06
202	0.08
203	0.08
204	0.08
205	0.1
206	0.13
207	0.14
208	0.16
209	0.17
210	0.19
211	0.19
212	0.2
213	0.18
214	0.16
215	0.19
216	0.18
217	0.17
218	0.16
219	0.15
220	0.16
221	0.18
222	0.2
223	0.17
224	0.17
225	0.2
226	0.23
227	0.23
228	0.23
229	0.2
230	0.18
231	0.17
232	0.16
233	0.12
234	0.08
235	0.07
236	0.07
237	0.07
238	0.07
239	0.1
240	0.12
241	0.16
242	0.18
243	0.2
244	0.27
245	0.3
246	0.34
247	0.37
248	0.42
249	0.42
250	0.47
251	0.47
252	0.42
253	0.4
254	0.35
255	0.3
256	0.25
257	0.22
258	0.15
259	0.14
260	0.12
261	0.12
262	0.15
263	0.14
264	0.12
265	0.11
266	0.09
267	0.09
268	0.08
269	0.08
270	0.06
271	0.12
272	0.12
273	0.14
274	0.15
275	0.15
276	0.16
277	0.18
278	0.18
279	0.14
280	0.14
281	0.14
282	0.12
283	0.13
284	0.12
285	0.08
286	0.07
287	0.05
288	0.05
289	0.04
290	0.04
291	0.04
292	0.03
293	0.05
294	0.05
295	0.07
296	0.07
297	0.1
298	0.12
299	0.16
300	0.21
301	0.25
302	0.3
303	0.31
304	0.34
305	0.36
306	0.37
307	0.35
308	0.33
309	0.31
310	0.27
311	0.31
312	0.34
313	0.34
314	0.32
315	0.39
316	0.38
317	0.43
318	0.43
319	0.39
320	0.34
321	0.33
322	0.33
323	0.25
324	0.24
325	0.15
326	0.13
327	0.12
328	0.11
329	0.09
330	0.08
331	0.07
332	0.07
333	0.07
334	0.06
335	0.07
336	0.06
337	0.05
338	0.06
339	0.07
340	0.07
341	0.09
342	0.09
343	0.1
344	0.1
345	0.13
346	0.14
347	0.22
348	0.22
349	0.21
350	0.21
351	0.2
352	0.23
353	0.2
354	0.2
355	0.16
356	0.17
357	0.19
358	0.2
359	0.2
360	0.17
361	0.17
362	0.15
363	0.11
364	0.09
365	0.06
366	0.04
367	0.06
368	0.06
369	0.06
370	0.06
371	0.07
372	0.07
373	0.07
374	0.1
375	0.09
376	0.13
377	0.16
378	0.18
379	0.19
380	0.19
381	0.22
382	0.2
383	0.19
384	0.18
385	0.14
386	0.14
387	0.13
388	0.14
389	0.12
390	0.17
391	0.17
392	0.16
393	0.17
394	0.17
395	0.19
396	0.18
397	0.19
398	0.15
399	0.16
400	0.16
401	0.14
402	0.15
403	0.13
404	0.13
405	0.11
406	0.11
407	0.09
408	0.09
409	0.09
410	0.07
411	0.06
412	0.05
413	0.05
414	0.05
415	0.05
416	0.04
417	0.04
418	0.04
419	0.04
420	0.04
421	0.05
422	0.06
423	0.06
424	0.08
425	0.09
426	0.1
427	0.1
428	0.1
429	0.12
430	0.12
431	0.15
432	0.13
433	0.13
434	0.14
435	0.15
436	0.18
437	0.16
438	0.16
439	0.15
440	0.15
441	0.15
442	0.15
443	0.14
444	0.1
445	0.11
446	0.1
447	0.08
448	0.08
449	0.07
450	0.06
451	0.06
452	0.05
453	0.04
454	0.03
455	0.03
456	0.03
457	0.03
458	0.04
459	0.06
460	0.06
461	0.06
462	0.08
463	0.08
464	0.1
465	0.13
466	0.17
467	0.17
468	0.22
469	0.23
470	0.23
471	0.25
472	0.23
473	0.2
474	0.16
475	0.14
476	0.1
477	0.12
478	0.12
479	0.09
480	0.1
481	0.1
482	0.11
483	0.12
484	0.11
485	0.08
486	0.08
487	0.09
488	0.09
489	0.09
490	0.08
491	0.09
492	0.08
493	0.09
494	0.09
495	0.08
496	0.07
497	0.07
498	0.08
499	0.07
500	0.11
501	0.12
502	0.13
503	0.14
504	0.15
505	0.2
506	0.22
507	0.27
508	0.26
509	0.28
510	0.27
511	0.3
512	0.36
513	0.31
514	0.31
515	0.28
516	0.27
517	0.25
518	0.27
519	0.27
520	0.22
521	0.24
522	0.24
523	0.22
524	0.23
525	0.21
526	0.2
527	0.18
528	0.18
529	0.16
530	0.15
531	0.13
532	0.15
533	0.17
534	0.19
535	0.18
536	0.18
537	0.17
538	0.2
539	0.2
540	0.17
541	0.16
542	0.13
543	0.11

Q10144

3D AlphaFold-predicted Structure Viewer