Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BP85

Protein Details
Accession A0A0D2BP85   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-113ASPESRHRTRSHRTPPKRKTTSRNGQHQSKVEHydrophilic
NLS Segment(s)
PositionSequence
88-100HRTRSHRTPPKRK
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MFIPGSRFSTQLGFLGSCRVSTNEYESLRYLYVIPPPPTDVASLFHPARSLYELLLSQESSSRLLLHSSSLSSRSLLKHCRASPESRHRTRSHRTPPKRKTTSRNGQHQSKVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.19
4 0.17
5 0.17
6 0.17
7 0.16
8 0.17
9 0.22
10 0.24
11 0.25
12 0.27
13 0.27
14 0.27
15 0.25
16 0.24
17 0.19
18 0.14
19 0.19
20 0.23
21 0.24
22 0.23
23 0.25
24 0.25
25 0.25
26 0.24
27 0.18
28 0.14
29 0.15
30 0.19
31 0.17
32 0.16
33 0.16
34 0.15
35 0.15
36 0.15
37 0.13
38 0.08
39 0.09
40 0.09
41 0.1
42 0.11
43 0.09
44 0.07
45 0.08
46 0.09
47 0.09
48 0.09
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.1
59 0.11
60 0.13
61 0.15
62 0.2
63 0.25
64 0.28
65 0.35
66 0.36
67 0.44
68 0.45
69 0.48
70 0.53
71 0.58
72 0.64
73 0.64
74 0.69
75 0.65
76 0.7
77 0.73
78 0.73
79 0.74
80 0.74
81 0.78
82 0.83
83 0.89
84 0.92
85 0.92
86 0.91
87 0.89
88 0.89
89 0.89
90 0.87
91 0.88
92 0.85
93 0.84
94 0.83