Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P08090

Protein Details
Accession P08090    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-93HSVPMKRTKRVRRTPAQRIEHEBasic
NLS Segment(s)
PositionSequence
77-83KRTKRVR
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
Gene Ontology GO:0030291  F:protein serine/threonine kinase inhibitor activity  
GO:0051321  P:meiotic cell cycle  
GO:0140538  P:negative regulation of conjugation with zygote  
GO:0110046  P:signal transduction involved in cell cycle switching, mitotic to meiotic cell cycle  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG spo:SPBC119.04  -  
Amino Acid Sequences MSSQNTSNSRHPASSASALPNRTNTARRSTSPRTSTGSSSTNTNTKTVDHAGTTFISSTSKRGRSTKAGSVHSVPMKRTKRVRRTPAQRIEHENKENIQTEKVYRIKPVQRVLSPSDLTNELTILDLFHVPRPNETFDITDRVNNTSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.34
4 0.35
5 0.37
6 0.37
7 0.37
8 0.36
9 0.36
10 0.37
11 0.33
12 0.38
13 0.39
14 0.41
15 0.47
16 0.51
17 0.56
18 0.55
19 0.56
20 0.53
21 0.51
22 0.5
23 0.45
24 0.4
25 0.32
26 0.31
27 0.3
28 0.3
29 0.28
30 0.27
31 0.23
32 0.2
33 0.23
34 0.22
35 0.2
36 0.16
37 0.15
38 0.16
39 0.16
40 0.15
41 0.12
42 0.09
43 0.1
44 0.09
45 0.13
46 0.18
47 0.22
48 0.25
49 0.27
50 0.31
51 0.37
52 0.42
53 0.44
54 0.44
55 0.43
56 0.41
57 0.4
58 0.4
59 0.37
60 0.33
61 0.27
62 0.3
63 0.31
64 0.35
65 0.42
66 0.48
67 0.55
68 0.63
69 0.71
70 0.72
71 0.79
72 0.84
73 0.85
74 0.82
75 0.75
76 0.74
77 0.71
78 0.69
79 0.62
80 0.54
81 0.45
82 0.42
83 0.41
84 0.34
85 0.29
86 0.23
87 0.22
88 0.28
89 0.31
90 0.28
91 0.28
92 0.35
93 0.4
94 0.45
95 0.5
96 0.49
97 0.47
98 0.51
99 0.52
100 0.5
101 0.45
102 0.38
103 0.34
104 0.29
105 0.27
106 0.23
107 0.18
108 0.12
109 0.12
110 0.11
111 0.08
112 0.08
113 0.09
114 0.1
115 0.14
116 0.2
117 0.2
118 0.24
119 0.28
120 0.31
121 0.31
122 0.33
123 0.32
124 0.29
125 0.34
126 0.31
127 0.31
128 0.28