Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O74969

Protein Details
Accession O74969    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
484-505KLNYSEQKKVEKEKSRKGGARGBasic
NLS Segment(s)
PositionSequence
497-500KSRK
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020846  MFS_dom  
IPR005828  MFS_sugar_transport-like  
IPR036259  MFS_trans_sf  
IPR003663  Sugar/inositol_transpt  
IPR005829  Sugar_transporter_CS  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0005351  F:carbohydrate:proton symporter activity  
GO:0005354  F:galactose transmembrane transporter activity  
GO:0008643  P:carbohydrate transport  
GO:0140425  P:galactose import across plasma membrane  
GO:0046323  P:glucose import  
KEGG spo:SPBC4B4.08  -  
Pfam View protein in Pfam  
PF00083  Sugar_tr  
PROSITE View protein in PROSITE  
PS50850  MFS  
PS00216  SUGAR_TRANSPORT_1  
CDD cd17356  MFS_HXT  
Amino Acid Sequences MGFKRGKNFTLVMLIFVSMAGWMFGADTGSIGGVTSMRDFRERYADRYDPITDQYSLSSARQGLLTGMVNVGSLFGCIISSPIADRFGKRLSIIGFCAVYIIGIIVQVTAVPSWVQIMVAKIWTGIGIGALSVLAPGYQSETAPPSIRGTVVVTYQLFVTGGIFIAACINMGTHKLHKTAQWRVSIGINLLWGIITMIGILFLPESPRYLIQVGKDEEAVRVLSESAELFPDSEEVQNEYHRLKSSIDEEFAGGPCSWASIFGKDIRYRTFLGMFVMSLQQLTGNNYFFYYGFSVMQGAGINSPYLSAMILDAVNFGCTFGGMYVLERFGRRNPLIIGGIWQSICFFIYSAVGSRALYHKNGTSNTRAGAVMIVMACLFIFGFAQTWAPAAYVIVGESYPVRYRSKCAAVATASNWLWNFLISFFTPFIQASIGFKYGYVFASCNLTGAIVIFLFAKETKGLTLEEINELYMSVIKPWESGNFKLNYSEQKKVEKEKSRKGGARGESVEYVERASNTDSSPQYSSHEEDYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.19
4 0.16
5 0.07
6 0.07
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.05
21 0.06
22 0.09
23 0.12
24 0.13
25 0.17
26 0.18
27 0.21
28 0.31
29 0.33
30 0.35
31 0.41
32 0.43
33 0.42
34 0.45
35 0.45
36 0.36
37 0.37
38 0.36
39 0.29
40 0.26
41 0.25
42 0.23
43 0.22
44 0.21
45 0.2
46 0.17
47 0.17
48 0.17
49 0.16
50 0.14
51 0.15
52 0.15
53 0.12
54 0.12
55 0.11
56 0.1
57 0.1
58 0.1
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.07
69 0.09
70 0.13
71 0.15
72 0.17
73 0.2
74 0.22
75 0.24
76 0.23
77 0.25
78 0.23
79 0.25
80 0.25
81 0.23
82 0.2
83 0.18
84 0.18
85 0.14
86 0.11
87 0.08
88 0.07
89 0.04
90 0.04
91 0.04
92 0.03
93 0.03
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.09
106 0.1
107 0.1
108 0.09
109 0.09
110 0.08
111 0.07
112 0.06
113 0.05
114 0.04
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.02
122 0.03
123 0.03
124 0.06
125 0.06
126 0.07
127 0.08
128 0.11
129 0.13
130 0.14
131 0.15
132 0.15
133 0.15
134 0.15
135 0.15
136 0.15
137 0.14
138 0.13
139 0.15
140 0.13
141 0.13
142 0.13
143 0.12
144 0.1
145 0.09
146 0.08
147 0.05
148 0.05
149 0.05
150 0.04
151 0.04
152 0.05
153 0.05
154 0.04
155 0.04
156 0.04
157 0.04
158 0.06
159 0.08
160 0.11
161 0.14
162 0.16
163 0.18
164 0.22
165 0.29
166 0.36
167 0.41
168 0.41
169 0.4
170 0.39
171 0.39
172 0.36
173 0.29
174 0.21
175 0.15
176 0.11
177 0.1
178 0.08
179 0.06
180 0.05
181 0.04
182 0.03
183 0.03
184 0.02
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.05
192 0.06
193 0.07
194 0.07
195 0.09
196 0.1
197 0.12
198 0.12
199 0.19
200 0.2
201 0.19
202 0.2
203 0.19
204 0.18
205 0.17
206 0.15
207 0.09
208 0.07
209 0.07
210 0.06
211 0.06
212 0.06
213 0.05
214 0.06
215 0.06
216 0.05
217 0.05
218 0.06
219 0.06
220 0.07
221 0.07
222 0.08
223 0.09
224 0.1
225 0.11
226 0.11
227 0.12
228 0.13
229 0.13
230 0.13
231 0.14
232 0.17
233 0.17
234 0.17
235 0.16
236 0.15
237 0.15
238 0.14
239 0.14
240 0.1
241 0.08
242 0.07
243 0.07
244 0.06
245 0.07
246 0.07
247 0.06
248 0.08
249 0.11
250 0.16
251 0.17
252 0.19
253 0.2
254 0.22
255 0.22
256 0.22
257 0.2
258 0.16
259 0.15
260 0.14
261 0.12
262 0.1
263 0.09
264 0.08
265 0.06
266 0.06
267 0.05
268 0.06
269 0.08
270 0.09
271 0.09
272 0.1
273 0.1
274 0.11
275 0.1
276 0.11
277 0.1
278 0.09
279 0.08
280 0.08
281 0.09
282 0.08
283 0.09
284 0.07
285 0.06
286 0.05
287 0.05
288 0.05
289 0.05
290 0.05
291 0.04
292 0.04
293 0.04
294 0.03
295 0.03
296 0.04
297 0.04
298 0.04
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.04
305 0.04
306 0.04
307 0.03
308 0.04
309 0.04
310 0.05
311 0.06
312 0.07
313 0.08
314 0.09
315 0.1
316 0.12
317 0.19
318 0.19
319 0.2
320 0.2
321 0.23
322 0.23
323 0.22
324 0.22
325 0.16
326 0.17
327 0.14
328 0.13
329 0.1
330 0.09
331 0.09
332 0.07
333 0.06
334 0.05
335 0.06
336 0.06
337 0.07
338 0.09
339 0.09
340 0.09
341 0.1
342 0.13
343 0.15
344 0.16
345 0.16
346 0.18
347 0.21
348 0.25
349 0.27
350 0.28
351 0.27
352 0.27
353 0.27
354 0.24
355 0.2
356 0.17
357 0.13
358 0.1
359 0.08
360 0.07
361 0.05
362 0.05
363 0.05
364 0.04
365 0.04
366 0.03
367 0.03
368 0.03
369 0.04
370 0.04
371 0.05
372 0.05
373 0.06
374 0.06
375 0.06
376 0.06
377 0.05
378 0.05
379 0.05
380 0.05
381 0.05
382 0.05
383 0.05
384 0.06
385 0.08
386 0.1
387 0.13
388 0.17
389 0.17
390 0.22
391 0.28
392 0.34
393 0.36
394 0.35
395 0.36
396 0.35
397 0.37
398 0.34
399 0.34
400 0.28
401 0.26
402 0.24
403 0.21
404 0.18
405 0.16
406 0.15
407 0.09
408 0.11
409 0.1
410 0.12
411 0.11
412 0.12
413 0.13
414 0.12
415 0.12
416 0.11
417 0.11
418 0.11
419 0.13
420 0.14
421 0.13
422 0.13
423 0.13
424 0.14
425 0.15
426 0.14
427 0.12
428 0.11
429 0.16
430 0.16
431 0.16
432 0.14
433 0.13
434 0.11
435 0.11
436 0.11
437 0.05
438 0.06
439 0.06
440 0.06
441 0.07
442 0.08
443 0.08
444 0.08
445 0.09
446 0.1
447 0.11
448 0.12
449 0.13
450 0.16
451 0.16
452 0.18
453 0.18
454 0.18
455 0.16
456 0.15
457 0.13
458 0.12
459 0.11
460 0.1
461 0.11
462 0.11
463 0.12
464 0.13
465 0.2
466 0.22
467 0.25
468 0.31
469 0.32
470 0.33
471 0.36
472 0.39
473 0.42
474 0.43
475 0.49
476 0.46
477 0.52
478 0.58
479 0.64
480 0.7
481 0.7
482 0.74
483 0.77
484 0.82
485 0.83
486 0.83
487 0.8
488 0.79
489 0.74
490 0.73
491 0.66
492 0.61
493 0.53
494 0.48
495 0.44
496 0.35
497 0.32
498 0.24
499 0.22
500 0.19
501 0.2
502 0.2
503 0.19
504 0.26
505 0.26
506 0.28
507 0.3
508 0.29
509 0.3
510 0.32
511 0.34