Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O14240

Protein Details
Accession O14240   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-133LDDSTETSRRRKRKNESDSHEGRRRSBasic
NLS Segment(s)
PositionSequence
116-123RRRKRKNE
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0005829  C:cytosol  
GO:0036410  C:Mst2 histone acetyltransferase complex  
GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
KEGG spo:SPAC6F6.09  -  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MSTPNSTPSEPPVNVSYYEQCKKELHEMIEKRQLLETSLIGLEDSIYRLEGSYLEKTSGTGNIIRGFEGLLKNNASNLRRRADYSESDRLFSLSSLSSPHTRSPAYDLDDSTETSRRRKRKNESDSHEGRRRSSFREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.33
4 0.34
5 0.39
6 0.37
7 0.37
8 0.36
9 0.38
10 0.43
11 0.43
12 0.39
13 0.43
14 0.47
15 0.5
16 0.58
17 0.54
18 0.47
19 0.43
20 0.39
21 0.31
22 0.28
23 0.21
24 0.14
25 0.14
26 0.13
27 0.1
28 0.1
29 0.08
30 0.06
31 0.07
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.09
39 0.11
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.13
46 0.11
47 0.1
48 0.11
49 0.13
50 0.14
51 0.13
52 0.12
53 0.11
54 0.12
55 0.12
56 0.12
57 0.1
58 0.11
59 0.11
60 0.13
61 0.17
62 0.16
63 0.2
64 0.23
65 0.25
66 0.25
67 0.27
68 0.29
69 0.3
70 0.34
71 0.35
72 0.41
73 0.38
74 0.38
75 0.37
76 0.33
77 0.28
78 0.23
79 0.17
80 0.08
81 0.08
82 0.09
83 0.11
84 0.14
85 0.15
86 0.18
87 0.19
88 0.19
89 0.2
90 0.23
91 0.26
92 0.28
93 0.28
94 0.26
95 0.27
96 0.28
97 0.28
98 0.26
99 0.27
100 0.25
101 0.31
102 0.4
103 0.45
104 0.54
105 0.63
106 0.71
107 0.76
108 0.85
109 0.87
110 0.87
111 0.88
112 0.87
113 0.87
114 0.84
115 0.76
116 0.68
117 0.67
118 0.62