Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2C6D2

Protein Details
Accession A0A0D2C6D2    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
21-40TEPVRKRKAGTTTKKRTAKPBasic
NLS Segment(s)
PositionSequence
25-101RKRKAGTTTKKRTAKPKSTTGAGVTKKRAPAKSKSSLKDKVEGAVEKVAGAVERKPGKKAAGTKKIKGTDGKTSKAV
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MAQTRGATGNAKPRIFTTPSTEPVRKRKAGTTTKKRTAKPKSTTGAGVTKKRAPAKSKSSLKDKVEGAVEKVAGAVERKPGKKAAGTKKIKGTDGKTSKAVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.35
5 0.34
6 0.4
7 0.47
8 0.5
9 0.5
10 0.57
11 0.63
12 0.59
13 0.55
14 0.56
15 0.58
16 0.64
17 0.69
18 0.7
19 0.72
20 0.78
21 0.82
22 0.8
23 0.8
24 0.79
25 0.78
26 0.74
27 0.72
28 0.66
29 0.61
30 0.58
31 0.51
32 0.48
33 0.43
34 0.41
35 0.35
36 0.34
37 0.36
38 0.39
39 0.41
40 0.37
41 0.4
42 0.44
43 0.51
44 0.57
45 0.57
46 0.6
47 0.64
48 0.61
49 0.59
50 0.51
51 0.44
52 0.4
53 0.36
54 0.3
55 0.24
56 0.22
57 0.16
58 0.15
59 0.13
60 0.09
61 0.1
62 0.09
63 0.14
64 0.21
65 0.23
66 0.25
67 0.28
68 0.3
69 0.35
70 0.44
71 0.48
72 0.52
73 0.58
74 0.62
75 0.68
76 0.7
77 0.68
78 0.65
79 0.6
80 0.6
81 0.6
82 0.58
83 0.56