Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9C0X7

Protein Details
Accession Q9C0X7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
47-70ITDCPEIKNKKSRRKNQRNSSSIGHydrophilic
NLS Segment(s)
PositionSequence
56-61KKSRRK
Subcellular Location(s) mito 8, plas 7, nucl 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
KEGG spo:SPAPB8E5.08  -  
Amino Acid Sequences MRKLRCKQMIPKLLPFIFIYLSVANKIMFYCILNERAFKHYKTYRRITDCPEIKNKKSRRKNQRNSSSIGLSNPNKFSIYIYIYFFFYSFLCSPYLFKYISLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.51
3 0.41
4 0.32
5 0.26
6 0.21
7 0.13
8 0.14
9 0.12
10 0.13
11 0.11
12 0.1
13 0.1
14 0.09
15 0.08
16 0.08
17 0.1
18 0.12
19 0.16
20 0.17
21 0.18
22 0.2
23 0.24
24 0.27
25 0.24
26 0.3
27 0.32
28 0.4
29 0.46
30 0.51
31 0.53
32 0.58
33 0.6
34 0.58
35 0.61
36 0.57
37 0.54
38 0.57
39 0.55
40 0.51
41 0.57
42 0.6
43 0.61
44 0.67
45 0.73
46 0.75
47 0.81
48 0.88
49 0.9
50 0.92
51 0.85
52 0.8
53 0.74
54 0.66
55 0.55
56 0.47
57 0.43
58 0.35
59 0.35
60 0.32
61 0.29
62 0.26
63 0.25
64 0.24
65 0.21
66 0.22
67 0.21
68 0.22
69 0.22
70 0.22
71 0.22
72 0.2
73 0.17
74 0.13
75 0.16
76 0.14
77 0.14
78 0.15
79 0.15
80 0.17
81 0.2
82 0.23
83 0.18