Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2DQT3

Protein Details
Accession A0A0D2DQT3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
160-182ERRKVKGKAYYERKKVARRQLAEBasic
NLS Segment(s)
PositionSequence
161-177RRKVKGKAYYERKKVAR
Subcellular Location(s) cyto 10.5, cyto_nucl 10, nucl 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR023563  Ribosomal_L13_CS  
IPR005755  Ribosomal_L13_euk/arc  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
PROSITE View protein in PROSITE  
PS00783  RIBOSOMAL_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MSTFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAEALNISGEFFRAKLKYHAYLRKITRYNPTRGGPFHFRAPARIFYKTVRGMIPHKTARGAAAMDRLKVFEGIPPPYDKKQRMVVPQALRVLRLKPGRKYCTVGRLAHEVGWKYQDVVARLEERRKVKGKAYYERKKVARRQLAEAQKSSSSETKQKLAALGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.1
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.15
11 0.16
12 0.15
13 0.14
14 0.21
15 0.28
16 0.3
17 0.29
18 0.25
19 0.26
20 0.26
21 0.27
22 0.2
23 0.13
24 0.12
25 0.12
26 0.13
27 0.1
28 0.1
29 0.1
30 0.09
31 0.1
32 0.08
33 0.08
34 0.08
35 0.08
36 0.12
37 0.11
38 0.13
39 0.17
40 0.22
41 0.29
42 0.37
43 0.45
44 0.45
45 0.52
46 0.55
47 0.59
48 0.57
49 0.54
50 0.56
51 0.54
52 0.56
53 0.54
54 0.53
55 0.48
56 0.46
57 0.49
58 0.45
59 0.41
60 0.4
61 0.38
62 0.36
63 0.36
64 0.37
65 0.39
66 0.35
67 0.35
68 0.32
69 0.28
70 0.35
71 0.32
72 0.3
73 0.24
74 0.23
75 0.24
76 0.28
77 0.33
78 0.28
79 0.27
80 0.26
81 0.25
82 0.23
83 0.22
84 0.17
85 0.1
86 0.16
87 0.16
88 0.15
89 0.15
90 0.15
91 0.14
92 0.14
93 0.13
94 0.09
95 0.11
96 0.12
97 0.13
98 0.16
99 0.19
100 0.23
101 0.3
102 0.29
103 0.3
104 0.35
105 0.39
106 0.43
107 0.46
108 0.49
109 0.46
110 0.48
111 0.5
112 0.43
113 0.39
114 0.34
115 0.29
116 0.28
117 0.32
118 0.34
119 0.37
120 0.46
121 0.49
122 0.51
123 0.55
124 0.53
125 0.54
126 0.55
127 0.5
128 0.43
129 0.44
130 0.41
131 0.39
132 0.38
133 0.3
134 0.25
135 0.25
136 0.22
137 0.18
138 0.19
139 0.19
140 0.17
141 0.18
142 0.2
143 0.23
144 0.26
145 0.3
146 0.34
147 0.35
148 0.41
149 0.45
150 0.46
151 0.48
152 0.54
153 0.57
154 0.61
155 0.69
156 0.71
157 0.74
158 0.79
159 0.8
160 0.81
161 0.81
162 0.81
163 0.8
164 0.74
165 0.74
166 0.74
167 0.77
168 0.74
169 0.67
170 0.6
171 0.53
172 0.5
173 0.47
174 0.43
175 0.38
176 0.4
177 0.41
178 0.42
179 0.42
180 0.42