Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2D0X5

Protein Details
Accession A0A0D2D0X5   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-89PEEFKETRKKCKARKMEEEERRRQVBasic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 10.833, cyto_mito 10.333, nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSPTAQVYSFMPVSGNPQHKRPRQGYEEIDRLYKCGWNGCEKTYGTLNHLNAHVNTQSHGTKITPEEFKETRKKCKARKMEEEERRRQVVAEACKLTMQLEMQTELRSQVMNGTETDLRFLLSTLNVQTDKLRGEIVNIKAECSTHMKMGGWAAMLTISVVYMAHMVRSTGSVKVKASGYLMALAQCLFVFPID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.32
4 0.4
5 0.5
6 0.57
7 0.66
8 0.66
9 0.67
10 0.65
11 0.71
12 0.7
13 0.68
14 0.69
15 0.61
16 0.59
17 0.5
18 0.45
19 0.38
20 0.32
21 0.25
22 0.24
23 0.25
24 0.29
25 0.32
26 0.32
27 0.37
28 0.35
29 0.36
30 0.35
31 0.34
32 0.3
33 0.34
34 0.32
35 0.29
36 0.3
37 0.3
38 0.25
39 0.26
40 0.23
41 0.17
42 0.17
43 0.18
44 0.17
45 0.15
46 0.16
47 0.14
48 0.14
49 0.17
50 0.21
51 0.2
52 0.21
53 0.27
54 0.27
55 0.33
56 0.4
57 0.42
58 0.48
59 0.55
60 0.62
61 0.64
62 0.72
63 0.76
64 0.76
65 0.82
66 0.81
67 0.82
68 0.83
69 0.85
70 0.82
71 0.76
72 0.69
73 0.58
74 0.48
75 0.41
76 0.38
77 0.33
78 0.3
79 0.26
80 0.25
81 0.25
82 0.25
83 0.21
84 0.16
85 0.11
86 0.08
87 0.07
88 0.09
89 0.09
90 0.1
91 0.1
92 0.09
93 0.1
94 0.08
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.11
101 0.13
102 0.13
103 0.14
104 0.11
105 0.1
106 0.09
107 0.09
108 0.07
109 0.06
110 0.08
111 0.07
112 0.1
113 0.1
114 0.11
115 0.12
116 0.13
117 0.13
118 0.12
119 0.13
120 0.1
121 0.13
122 0.2
123 0.22
124 0.27
125 0.27
126 0.27
127 0.26
128 0.26
129 0.25
130 0.24
131 0.23
132 0.17
133 0.18
134 0.18
135 0.19
136 0.2
137 0.19
138 0.13
139 0.12
140 0.1
141 0.08
142 0.08
143 0.07
144 0.05
145 0.04
146 0.03
147 0.03
148 0.04
149 0.05
150 0.05
151 0.06
152 0.07
153 0.07
154 0.07
155 0.1
156 0.11
157 0.15
158 0.19
159 0.21
160 0.22
161 0.26
162 0.27
163 0.26
164 0.26
165 0.23
166 0.2
167 0.19
168 0.19
169 0.15
170 0.15
171 0.13
172 0.12
173 0.1
174 0.09