Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2TRU5

Protein Details
Accession G2TRU5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-30FDLRKQHQKLLKKNCQKEIEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 12, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0005739  C:mitochondrion  
GO:0005507  F:copper ion binding  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MNKSPIEEEFDLRKQHQKLLKKNCQKEIEDFVKCATGRTFSVTWKCRSENKTMKDCLTKAADEISEWQIRSEYNKAKQESFIGKQDEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.48
4 0.51
5 0.56
6 0.63
7 0.71
8 0.74
9 0.8
10 0.81
11 0.8
12 0.74
13 0.69
14 0.66
15 0.63
16 0.54
17 0.46
18 0.38
19 0.35
20 0.32
21 0.28
22 0.2
23 0.15
24 0.14
25 0.18
26 0.18
27 0.17
28 0.26
29 0.28
30 0.31
31 0.32
32 0.34
33 0.36
34 0.39
35 0.45
36 0.46
37 0.49
38 0.53
39 0.52
40 0.53
41 0.52
42 0.48
43 0.43
44 0.37
45 0.31
46 0.24
47 0.23
48 0.2
49 0.16
50 0.19
51 0.19
52 0.18
53 0.18
54 0.18
55 0.17
56 0.17
57 0.21
58 0.26
59 0.29
60 0.35
61 0.43
62 0.46
63 0.47
64 0.49
65 0.52
66 0.52
67 0.49
68 0.47
69 0.47