Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UTI8

Protein Details
Accession Q9UTI8   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNIPKTRKTYCPGKNCRKHTVHRVTQYKKHydrophilic
NLS Segment(s)
PositionSequence
40-42KRR
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG spo:SPAC15E1.03  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRKTYCPGKNCRKHTVHRVTQYKKGPDSKLAQGKRRYDRKQSGFGGQTKPVFHKKAKVTKKVVLRLECVSCKYKNQLVLKRCKHFELGGEKKTKGAAIQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.82
4 0.86
5 0.83
6 0.82
7 0.82
8 0.82
9 0.8
10 0.8
11 0.83
12 0.78
13 0.79
14 0.78
15 0.73
16 0.69
17 0.67
18 0.59
19 0.56
20 0.55
21 0.55
22 0.57
23 0.57
24 0.58
25 0.58
26 0.64
27 0.67
28 0.72
29 0.69
30 0.69
31 0.73
32 0.7
33 0.71
34 0.65
35 0.62
36 0.57
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.27
46 0.32
47 0.37
48 0.45
49 0.53
50 0.59
51 0.59
52 0.61
53 0.68
54 0.69
55 0.67
56 0.6
57 0.55
58 0.5
59 0.48
60 0.44
61 0.4
62 0.36
63 0.31
64 0.31
65 0.34
66 0.34
67 0.37
68 0.44
69 0.49
70 0.54
71 0.63
72 0.69
73 0.72
74 0.71
75 0.65
76 0.6
77 0.53
78 0.52
79 0.52
80 0.52
81 0.52
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42