Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9HDZ3

Protein Details
Accession Q9HDZ3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-182KKESNEKRLSEKKYKQKKKTQRRITMDBasic
NLS Segment(s)
PositionSequence
156-178KKESNEKRLSEKKYKQKKKTQRR
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0004045  F:aminoacyl-tRNA hydrolase activity  
GO:0003747  F:translation release factor activity  
GO:0016150  F:translation release factor activity, codon nonspecific  
GO:0051321  P:meiotic cell cycle  
GO:0070126  P:mitochondrial translational termination  
KEGG spo:SPAC589.11  -  
Pfam View protein in Pfam  
PF00472  RF-1  
PROSITE View protein in PROSITE  
PS00745  RF_PROK_I  
Amino Acid Sequences MFANFRNCFKIKNSRLIYDNINKCLLTKEETNQLLKFIHLKWKPAKDQVQISFSRSSGPGGQNVNKLNTKVIVNLPFKQLESCIPMFLINHFKTCEMLRNYRIQNGIKIYSQKTRSQHKNIEDALNKISDLLNKSAETLYVPDTPPEKIARISILKKESNEKRLSEKKYKQKKKTQRRITMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.57
4 0.58
5 0.57
6 0.57
7 0.5
8 0.47
9 0.42
10 0.39
11 0.39
12 0.33
13 0.28
14 0.25
15 0.25
16 0.32
17 0.36
18 0.38
19 0.35
20 0.35
21 0.3
22 0.28
23 0.28
24 0.21
25 0.28
26 0.26
27 0.33
28 0.39
29 0.47
30 0.51
31 0.56
32 0.61
33 0.57
34 0.63
35 0.61
36 0.59
37 0.52
38 0.5
39 0.43
40 0.36
41 0.32
42 0.24
43 0.21
44 0.2
45 0.2
46 0.21
47 0.23
48 0.26
49 0.29
50 0.31
51 0.33
52 0.3
53 0.29
54 0.25
55 0.23
56 0.21
57 0.18
58 0.2
59 0.24
60 0.25
61 0.26
62 0.28
63 0.27
64 0.26
65 0.24
66 0.21
67 0.15
68 0.16
69 0.15
70 0.13
71 0.12
72 0.12
73 0.12
74 0.13
75 0.19
76 0.15
77 0.16
78 0.16
79 0.16
80 0.17
81 0.17
82 0.23
83 0.19
84 0.23
85 0.24
86 0.31
87 0.32
88 0.34
89 0.37
90 0.31
91 0.31
92 0.3
93 0.29
94 0.24
95 0.27
96 0.27
97 0.29
98 0.32
99 0.35
100 0.37
101 0.45
102 0.52
103 0.56
104 0.61
105 0.58
106 0.62
107 0.59
108 0.61
109 0.53
110 0.47
111 0.4
112 0.33
113 0.28
114 0.22
115 0.2
116 0.15
117 0.16
118 0.16
119 0.16
120 0.16
121 0.18
122 0.17
123 0.16
124 0.14
125 0.13
126 0.14
127 0.15
128 0.16
129 0.17
130 0.18
131 0.18
132 0.2
133 0.21
134 0.19
135 0.17
136 0.19
137 0.22
138 0.27
139 0.31
140 0.36
141 0.4
142 0.42
143 0.44
144 0.52
145 0.55
146 0.57
147 0.58
148 0.53
149 0.57
150 0.62
151 0.69
152 0.7
153 0.71
154 0.73
155 0.8
156 0.87
157 0.88
158 0.9
159 0.93
160 0.93
161 0.95
162 0.95