Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BZG5

Protein Details
Accession A0A0D2BZG5    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-63SDKETRKHTITEQRREQNRRAQRVFRERRRAKKEYLKSKPTPRHLAPBasic
NLS Segment(s)
PositionSequence
33-56QNRRAQRVFRERRRAKKEYLKSKP
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MRRGNHDVAGDVDLVVSDKETRKHTITEQRREQNRRAQRVFRERRRAKKEYLKSKPTPRHLAPCVPEDTGCRSAKSSVNLETEEILHWIGQTSSTNTTPSSTSSHVFSDALTLQDQPHQQRQSSAHIVQETIFTFSSPQTLLPAHDSLIPKRRSPTSEVQAFLTATNRPGHTLWPHGAPPTLAACLFNAAAMGIDIDRVGEPKYMSPFYRPSFSATLSSPSPPVHPTTTTTTTSSTSPTMYLSPGPRSLRPCFAQVIFPHHACLDLLPLPKLRETAIMLVVRRAQQDGRCAMDSSSDHAEVQELKRDVYVRQGVRFRGTGELTREEYVLPDDESSRHCGNPWEGGSWAVSPWFAVKWKHLIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.11
5 0.14
6 0.19
7 0.23
8 0.29
9 0.31
10 0.35
11 0.43
12 0.5
13 0.57
14 0.63
15 0.69
16 0.74
17 0.81
18 0.84
19 0.83
20 0.82
21 0.82
22 0.82
23 0.8
24 0.78
25 0.79
26 0.83
27 0.86
28 0.86
29 0.88
30 0.86
31 0.89
32 0.9
33 0.86
34 0.85
35 0.85
36 0.84
37 0.84
38 0.85
39 0.85
40 0.84
41 0.88
42 0.88
43 0.86
44 0.85
45 0.8
46 0.79
47 0.75
48 0.74
49 0.67
50 0.62
51 0.56
52 0.48
53 0.43
54 0.36
55 0.37
56 0.36
57 0.34
58 0.3
59 0.28
60 0.31
61 0.34
62 0.35
63 0.33
64 0.31
65 0.34
66 0.33
67 0.32
68 0.29
69 0.26
70 0.22
71 0.19
72 0.13
73 0.09
74 0.08
75 0.08
76 0.07
77 0.08
78 0.08
79 0.1
80 0.14
81 0.15
82 0.16
83 0.15
84 0.17
85 0.16
86 0.17
87 0.18
88 0.17
89 0.17
90 0.18
91 0.19
92 0.19
93 0.18
94 0.16
95 0.15
96 0.14
97 0.14
98 0.12
99 0.12
100 0.11
101 0.15
102 0.19
103 0.2
104 0.27
105 0.28
106 0.28
107 0.33
108 0.35
109 0.38
110 0.41
111 0.38
112 0.33
113 0.31
114 0.31
115 0.26
116 0.26
117 0.19
118 0.15
119 0.13
120 0.1
121 0.11
122 0.1
123 0.11
124 0.1
125 0.09
126 0.09
127 0.09
128 0.1
129 0.12
130 0.13
131 0.12
132 0.16
133 0.17
134 0.19
135 0.28
136 0.29
137 0.27
138 0.3
139 0.33
140 0.31
141 0.36
142 0.41
143 0.4
144 0.42
145 0.42
146 0.4
147 0.37
148 0.35
149 0.29
150 0.22
151 0.15
152 0.12
153 0.13
154 0.12
155 0.12
156 0.12
157 0.15
158 0.15
159 0.18
160 0.17
161 0.17
162 0.18
163 0.17
164 0.16
165 0.14
166 0.13
167 0.11
168 0.1
169 0.08
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.02
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.05
187 0.06
188 0.06
189 0.08
190 0.12
191 0.13
192 0.14
193 0.17
194 0.22
195 0.22
196 0.25
197 0.24
198 0.25
199 0.25
200 0.26
201 0.25
202 0.2
203 0.22
204 0.2
205 0.2
206 0.17
207 0.16
208 0.16
209 0.15
210 0.17
211 0.16
212 0.16
213 0.19
214 0.24
215 0.28
216 0.28
217 0.28
218 0.27
219 0.26
220 0.26
221 0.24
222 0.18
223 0.15
224 0.13
225 0.13
226 0.12
227 0.12
228 0.15
229 0.16
230 0.18
231 0.23
232 0.25
233 0.28
234 0.32
235 0.34
236 0.37
237 0.36
238 0.36
239 0.34
240 0.32
241 0.34
242 0.3
243 0.35
244 0.32
245 0.31
246 0.29
247 0.26
248 0.25
249 0.2
250 0.18
251 0.13
252 0.14
253 0.15
254 0.16
255 0.19
256 0.19
257 0.2
258 0.21
259 0.18
260 0.17
261 0.17
262 0.19
263 0.21
264 0.23
265 0.23
266 0.24
267 0.26
268 0.26
269 0.24
270 0.24
271 0.22
272 0.22
273 0.28
274 0.3
275 0.31
276 0.3
277 0.3
278 0.28
279 0.3
280 0.27
281 0.25
282 0.26
283 0.22
284 0.21
285 0.2
286 0.22
287 0.21
288 0.22
289 0.26
290 0.22
291 0.22
292 0.24
293 0.25
294 0.24
295 0.28
296 0.35
297 0.3
298 0.37
299 0.42
300 0.42
301 0.45
302 0.46
303 0.39
304 0.36
305 0.36
306 0.34
307 0.34
308 0.36
309 0.35
310 0.35
311 0.34
312 0.28
313 0.26
314 0.23
315 0.2
316 0.16
317 0.14
318 0.14
319 0.16
320 0.19
321 0.24
322 0.24
323 0.22
324 0.23
325 0.27
326 0.29
327 0.35
328 0.34
329 0.31
330 0.29
331 0.29
332 0.3
333 0.25
334 0.22
335 0.14
336 0.12
337 0.1
338 0.12
339 0.13
340 0.16
341 0.19
342 0.23
343 0.31