Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40232

Protein Details
Accession P40232    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
200-222SATFKKQDVYKEKQKKRLQGAEAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016149  Casein_kin_II_reg-sub_N  
IPR035991  Casein_kinase_II_beta-like  
IPR000704  Casein_kinase_II_reg-sub  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0044732  C:mitotic spindle pole body  
GO:0005634  C:nucleus  
GO:0005956  C:protein kinase CK2 complex  
GO:0034456  C:UTP-C complex  
GO:0019887  F:protein kinase regulator activity  
GO:0043539  F:protein serine/threonine kinase activator activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0090053  P:positive regulation of pericentric heterochromatin formation  
GO:0006468  P:protein phosphorylation  
GO:0080163  P:regulation of protein serine/threonine phosphatase activity  
GO:0006359  P:regulation of transcription by RNA polymerase III  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF01214  CK_II_beta  
PROSITE View protein in PROSITE  
PS01101  CK2_BETA  
Amino Acid Sequences MQLYSSESESDDSQYWVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLILDVLDPDLPEEVQDEVEASARHLYGLIHARYILTAQGLYKMLEKYKKCDFGHCPRVLCNGQPMLPVGLSDIAHTKSVKLYCPRCEDVYTPKSQRHASIDGAYFGTSFPHMLFQVYPELAVPKSQERYIPRIFGFKVHSYSATFKKQDVYKEKQKKRLQGAEAESKNKLAIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.13
5 0.11
6 0.1
7 0.11
8 0.17
9 0.17
10 0.18
11 0.2
12 0.21
13 0.2
14 0.21
15 0.19
16 0.14
17 0.19
18 0.17
19 0.16
20 0.15
21 0.17
22 0.17
23 0.18
24 0.17
25 0.12
26 0.13
27 0.11
28 0.11
29 0.09
30 0.08
31 0.1
32 0.13
33 0.15
34 0.14
35 0.14
36 0.15
37 0.15
38 0.17
39 0.15
40 0.12
41 0.11
42 0.1
43 0.11
44 0.09
45 0.09
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.08
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.1
72 0.16
73 0.16
74 0.15
75 0.15
76 0.15
77 0.15
78 0.15
79 0.11
80 0.05
81 0.05
82 0.05
83 0.07
84 0.08
85 0.09
86 0.11
87 0.11
88 0.14
89 0.2
90 0.21
91 0.23
92 0.29
93 0.37
94 0.35
95 0.41
96 0.45
97 0.48
98 0.58
99 0.56
100 0.51
101 0.43
102 0.48
103 0.42
104 0.35
105 0.29
106 0.21
107 0.18
108 0.18
109 0.17
110 0.12
111 0.12
112 0.11
113 0.08
114 0.08
115 0.07
116 0.07
117 0.08
118 0.09
119 0.1
120 0.1
121 0.1
122 0.12
123 0.14
124 0.18
125 0.24
126 0.28
127 0.32
128 0.39
129 0.41
130 0.4
131 0.41
132 0.39
133 0.4
134 0.41
135 0.41
136 0.38
137 0.38
138 0.4
139 0.39
140 0.4
141 0.36
142 0.35
143 0.31
144 0.32
145 0.31
146 0.28
147 0.27
148 0.23
149 0.18
150 0.14
151 0.12
152 0.08
153 0.07
154 0.06
155 0.08
156 0.08
157 0.09
158 0.09
159 0.1
160 0.13
161 0.13
162 0.13
163 0.11
164 0.13
165 0.12
166 0.13
167 0.14
168 0.16
169 0.19
170 0.2
171 0.25
172 0.28
173 0.35
174 0.38
175 0.41
176 0.37
177 0.4
178 0.39
179 0.38
180 0.39
181 0.37
182 0.36
183 0.33
184 0.33
185 0.31
186 0.36
187 0.39
188 0.41
189 0.38
190 0.36
191 0.41
192 0.44
193 0.5
194 0.53
195 0.55
196 0.58
197 0.67
198 0.75
199 0.79
200 0.83
201 0.83
202 0.84
203 0.85
204 0.79
205 0.77
206 0.76
207 0.76
208 0.74
209 0.69
210 0.6
211 0.51