Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O14296

Protein Details
Accession O14296    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-34EQNRKWQSIIRKEQRQLDRQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0000815  C:ESCRT III complex  
GO:0005771  C:multivesicular body  
GO:0032509  P:endosome transport via multivesicular body sorting pathway  
GO:0045324  P:late endosome to vacuole transport  
GO:0015031  P:protein transport  
GO:0043328  P:protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
KEGG spo:SPAC9E9.14  -  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MQTVRSYFFGPTPQEQNRKWQSIIRKEQRQLDRQVYHLKAGRKKAEVQLKQLAKQSDITNMRILAKEIARANRHGKRLAESKALLGSLSLQLNDQMAMLKIQGTMQSSTKIMQDVSSLIRLPQLSETMRNLSMELTKAGVLEEMRDEMFLPVEDDEELMDLADEDEEVQEILTKYNVIPAPSEKAADAATHREQSLKQALPSLSNGIAKDSTEIDEEQLLDIRDKLDALKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.6
4 0.62
5 0.62
6 0.59
7 0.57
8 0.59
9 0.61
10 0.7
11 0.7
12 0.71
13 0.72
14 0.8
15 0.82
16 0.79
17 0.76
18 0.75
19 0.67
20 0.62
21 0.65
22 0.58
23 0.55
24 0.52
25 0.52
26 0.5
27 0.55
28 0.57
29 0.51
30 0.55
31 0.57
32 0.62
33 0.59
34 0.59
35 0.6
36 0.57
37 0.57
38 0.57
39 0.5
40 0.41
41 0.4
42 0.35
43 0.34
44 0.34
45 0.32
46 0.29
47 0.29
48 0.29
49 0.26
50 0.26
51 0.21
52 0.18
53 0.21
54 0.23
55 0.28
56 0.28
57 0.32
58 0.39
59 0.41
60 0.44
61 0.44
62 0.42
63 0.41
64 0.45
65 0.45
66 0.42
67 0.36
68 0.33
69 0.3
70 0.29
71 0.23
72 0.16
73 0.13
74 0.1
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.09
81 0.07
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.08
91 0.09
92 0.1
93 0.11
94 0.11
95 0.12
96 0.12
97 0.11
98 0.1
99 0.08
100 0.08
101 0.08
102 0.09
103 0.09
104 0.09
105 0.08
106 0.1
107 0.09
108 0.09
109 0.09
110 0.11
111 0.1
112 0.12
113 0.14
114 0.15
115 0.15
116 0.15
117 0.14
118 0.12
119 0.13
120 0.11
121 0.1
122 0.08
123 0.08
124 0.08
125 0.07
126 0.08
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.07
133 0.07
134 0.06
135 0.07
136 0.06
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.03
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.03
156 0.06
157 0.06
158 0.07
159 0.07
160 0.08
161 0.08
162 0.14
163 0.16
164 0.14
165 0.15
166 0.17
167 0.23
168 0.23
169 0.24
170 0.18
171 0.18
172 0.18
173 0.17
174 0.17
175 0.17
176 0.2
177 0.22
178 0.22
179 0.23
180 0.23
181 0.28
182 0.34
183 0.31
184 0.28
185 0.32
186 0.32
187 0.33
188 0.34
189 0.31
190 0.26
191 0.26
192 0.25
193 0.22
194 0.22
195 0.2
196 0.2
197 0.18
198 0.17
199 0.16
200 0.17
201 0.15
202 0.16
203 0.16
204 0.15
205 0.16
206 0.15
207 0.14
208 0.15
209 0.14
210 0.13
211 0.13