Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P7L9

Protein Details
Accession Q9P7L9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-108YGNEYQPSNRKRKRKHGFLSRIRSVNGRRVLRDRRQKGRMYLSHHydrophilic
NLS Segment(s)
PositionSequence
74-102RKRKRKHGFLSRIRSVNGRRVLRDRRQKG
Subcellular Location(s) mito 12, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG spo:SPBC21C3.04c  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MMFMQQFRNLLHPAMKGARNISILAGGGTMRGFPTRNPFNTATLYSSLPTMNIFGQMQQVRWKTYGNEYQPSNRKRKRKHGFLSRIRSVNGRRVLRDRRQKGRMYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.29
4 0.29
5 0.3
6 0.28
7 0.27
8 0.23
9 0.18
10 0.15
11 0.13
12 0.11
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.06
19 0.07
20 0.08
21 0.16
22 0.22
23 0.24
24 0.3
25 0.31
26 0.32
27 0.34
28 0.34
29 0.28
30 0.24
31 0.23
32 0.17
33 0.16
34 0.14
35 0.11
36 0.1
37 0.09
38 0.07
39 0.07
40 0.07
41 0.07
42 0.12
43 0.12
44 0.13
45 0.17
46 0.19
47 0.19
48 0.2
49 0.21
50 0.18
51 0.23
52 0.3
53 0.29
54 0.32
55 0.32
56 0.4
57 0.48
58 0.53
59 0.57
60 0.57
61 0.63
62 0.67
63 0.77
64 0.79
65 0.81
66 0.85
67 0.86
68 0.89
69 0.89
70 0.9
71 0.86
72 0.79
73 0.69
74 0.66
75 0.59
76 0.57
77 0.55
78 0.5
79 0.48
80 0.54
81 0.62
82 0.66
83 0.73
84 0.73
85 0.75
86 0.78
87 0.81
88 0.8