Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BE74

Protein Details
Accession A0A0D2BE74   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-113GISHPTRSSGKRKEHRTQRKHWPRLLENBasic
NLS Segment(s)
PositionSequence
95-105GKRKEHRTQRK
Subcellular Location(s) cyto_nucl 14, nucl 11, cyto 11, mito 3
Family & Domain DBs
Amino Acid Sequences MSNVNEVSRSPEEPETSKGVKAPIPTGMTQAPVQILVSKIREERRVAILKSRRPPTIDPFDLPVGDILVLEGGKEGLFVGAGRLLGISHPTRSSGKRKEHRTQRKHWPRLLENLDLAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.33
4 0.32
5 0.3
6 0.28
7 0.27
8 0.27
9 0.25
10 0.24
11 0.25
12 0.24
13 0.26
14 0.24
15 0.24
16 0.22
17 0.21
18 0.15
19 0.12
20 0.12
21 0.1
22 0.11
23 0.11
24 0.13
25 0.14
26 0.17
27 0.21
28 0.25
29 0.25
30 0.27
31 0.31
32 0.36
33 0.34
34 0.39
35 0.43
36 0.46
37 0.52
38 0.53
39 0.47
40 0.45
41 0.47
42 0.45
43 0.47
44 0.42
45 0.35
46 0.34
47 0.32
48 0.29
49 0.26
50 0.19
51 0.1
52 0.08
53 0.07
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.09
74 0.1
75 0.11
76 0.11
77 0.14
78 0.18
79 0.24
80 0.34
81 0.39
82 0.49
83 0.56
84 0.65
85 0.73
86 0.81
87 0.86
88 0.86
89 0.87
90 0.87
91 0.9
92 0.9
93 0.85
94 0.84
95 0.78
96 0.79
97 0.75
98 0.69