Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2AHT7

Protein Details
Accession A0A0D2AHT7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-83ITEHRRKTRRIQGKGNQQSPRNLRRRAKILHKNPRLQHydrophilic
NLS Segment(s)
PositionSequence
51-81RRKTRRIQGKGNQQSPRNLRRRAKILHKNPR
Subcellular Location(s) nucl 17, cyto_nucl 11.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MAASVAKQGTDGARKGHDKGDRQQVKPDRSSRAWRHSVQDKEKDEDITEHRRKTRRIQGKGNQQSPRNLRRRAKILHKNPRLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.37
4 0.39
5 0.4
6 0.45
7 0.53
8 0.55
9 0.55
10 0.62
11 0.63
12 0.63
13 0.64
14 0.62
15 0.57
16 0.54
17 0.62
18 0.6
19 0.6
20 0.6
21 0.55
22 0.56
23 0.58
24 0.61
25 0.58
26 0.59
27 0.53
28 0.5
29 0.49
30 0.44
31 0.36
32 0.31
33 0.28
34 0.3
35 0.32
36 0.33
37 0.39
38 0.43
39 0.46
40 0.53
41 0.59
42 0.59
43 0.63
44 0.69
45 0.72
46 0.78
47 0.84
48 0.84
49 0.8
50 0.73
51 0.73
52 0.72
53 0.73
54 0.71
55 0.7
56 0.7
57 0.72
58 0.76
59 0.77
60 0.79
61 0.8
62 0.82
63 0.84