Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2DN04

Protein Details
Accession A0A0D2DN04   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MDTTNVKRNDEGKRRKRKNEGLNRRKDTLIHydrophilic
NLS Segment(s)
PositionSequence
11-26EGKRRKRKNEGLNRRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MDTTNVKRNDEGKRRKRKNEGLNRRKDTLIKKAYELGEFDGIDVALIICKHGRYTTYRSRDHASWPPSVAEIQTAYPLPKNILPEDIEKRFSKHTREKKIASQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.9
4 0.9
5 0.9
6 0.91
7 0.92
8 0.91
9 0.92
10 0.88
11 0.8
12 0.73
13 0.68
14 0.62
15 0.61
16 0.58
17 0.49
18 0.45
19 0.47
20 0.46
21 0.41
22 0.35
23 0.27
24 0.22
25 0.2
26 0.18
27 0.13
28 0.11
29 0.1
30 0.08
31 0.06
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.07
40 0.11
41 0.18
42 0.27
43 0.35
44 0.38
45 0.4
46 0.44
47 0.44
48 0.45
49 0.46
50 0.4
51 0.35
52 0.33
53 0.31
54 0.27
55 0.27
56 0.21
57 0.14
58 0.12
59 0.1
60 0.1
61 0.11
62 0.11
63 0.12
64 0.13
65 0.13
66 0.14
67 0.17
68 0.17
69 0.19
70 0.21
71 0.26
72 0.32
73 0.34
74 0.36
75 0.35
76 0.36
77 0.42
78 0.45
79 0.48
80 0.52
81 0.59
82 0.65
83 0.73
84 0.76