Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9USI0

Protein Details
Accession Q9USI0   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-86FSFAKKIKPEAEQRKRKRTTEIHydrophilic
NLS Segment(s)
PositionSequence
69-82KKIKPEAEQRKRKR
Subcellular Location(s) mito_nucl 11.165, mito 11, nucl 10.5, cyto_nucl 9.5
Family & Domain DBs
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
Amino Acid Sequences MSTSRLLLPTTNQQQNSSPVIKEVDLNQNTPIPVVWQKTKKPPFVSFPRHEPSETIVISSKPRLFSFAKKIKPEAEQRKRKRTTEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.47
4 0.4
5 0.31
6 0.26
7 0.27
8 0.25
9 0.23
10 0.23
11 0.27
12 0.25
13 0.26
14 0.26
15 0.26
16 0.25
17 0.24
18 0.19
19 0.12
20 0.14
21 0.17
22 0.22
23 0.26
24 0.3
25 0.4
26 0.46
27 0.49
28 0.5
29 0.51
30 0.52
31 0.56
32 0.61
33 0.54
34 0.55
35 0.54
36 0.5
37 0.47
38 0.4
39 0.34
40 0.31
41 0.27
42 0.22
43 0.19
44 0.18
45 0.2
46 0.23
47 0.23
48 0.19
49 0.2
50 0.23
51 0.25
52 0.31
53 0.4
54 0.45
55 0.5
56 0.52
57 0.55
58 0.55
59 0.59
60 0.63
61 0.64
62 0.66
63 0.69
64 0.75
65 0.82
66 0.86