Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9US26

Protein Details
Accession Q9US26    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-41DSDSQQKKTKRTVAHRSPNTTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025213  Sim4_Fta2  
Gene Ontology GO:0000939  C:inner kinetochore  
GO:0000776  C:kinetochore  
GO:0005874  C:microtubule  
GO:0031511  C:Mis6-Sim4 complex  
GO:0005634  C:nucleus  
GO:0051315  P:attachment of mitotic spindle microtubules to kinetochore  
GO:0051301  P:cell division  
GO:0000070  P:mitotic sister chromatid segregation  
KEGG spo:SPAC1783.03  -  
Pfam View protein in Pfam  
PF13095  FTA2  
Amino Acid Sequences MSGRRYSQISQQEGSSSSDDSDSQQKKTKRTVAHRSPNTTLNGMPRVDSRARPNENSGQSKSSNGRVDTDRKMDLLRKRSNLVHQTLLLEKEVRVRRNAINQRDDSFLSGFIKSLLEIDSSVVIYNTENPDNPKTKQVMPSAEPKKHVKLNSSISSIRFTQHEFEAESEKIIHHSLKGDIEYLPSFKFLLEIKVRTIDYALLFITYKIPHFARKELSSFSDSAIQCLDIVALLRAFSLFAHHYSYRCNTWFYLSKHMKKVASANMDAQCFYVQNSFYKITILYEIKFDDLGFVQPNYCISYILKNQNEKIVSITSKLLNQLDKRFSEFVSLFGFREGSLLLLQALFKPHLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.32
3 0.24
4 0.2
5 0.19
6 0.19
7 0.19
8 0.27
9 0.27
10 0.3
11 0.38
12 0.42
13 0.48
14 0.57
15 0.62
16 0.62
17 0.69
18 0.76
19 0.78
20 0.84
21 0.86
22 0.83
23 0.79
24 0.75
25 0.68
26 0.59
27 0.5
28 0.46
29 0.42
30 0.35
31 0.33
32 0.29
33 0.32
34 0.33
35 0.36
36 0.38
37 0.43
38 0.48
39 0.5
40 0.55
41 0.57
42 0.61
43 0.63
44 0.58
45 0.53
46 0.48
47 0.5
48 0.47
49 0.45
50 0.43
51 0.37
52 0.38
53 0.39
54 0.45
55 0.45
56 0.46
57 0.4
58 0.35
59 0.37
60 0.39
61 0.42
62 0.45
63 0.47
64 0.46
65 0.49
66 0.53
67 0.58
68 0.59
69 0.55
70 0.49
71 0.42
72 0.41
73 0.4
74 0.37
75 0.29
76 0.22
77 0.18
78 0.24
79 0.28
80 0.28
81 0.28
82 0.31
83 0.34
84 0.44
85 0.52
86 0.52
87 0.54
88 0.54
89 0.54
90 0.53
91 0.49
92 0.4
93 0.32
94 0.26
95 0.19
96 0.17
97 0.14
98 0.12
99 0.12
100 0.09
101 0.09
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.06
112 0.09
113 0.11
114 0.11
115 0.12
116 0.16
117 0.21
118 0.25
119 0.26
120 0.28
121 0.29
122 0.31
123 0.36
124 0.38
125 0.37
126 0.36
127 0.45
128 0.47
129 0.46
130 0.47
131 0.44
132 0.44
133 0.44
134 0.44
135 0.38
136 0.38
137 0.42
138 0.42
139 0.43
140 0.4
141 0.36
142 0.36
143 0.33
144 0.26
145 0.2
146 0.17
147 0.15
148 0.14
149 0.14
150 0.13
151 0.13
152 0.16
153 0.15
154 0.14
155 0.12
156 0.11
157 0.11
158 0.11
159 0.1
160 0.07
161 0.08
162 0.09
163 0.1
164 0.1
165 0.1
166 0.09
167 0.11
168 0.11
169 0.11
170 0.09
171 0.09
172 0.09
173 0.07
174 0.09
175 0.08
176 0.13
177 0.15
178 0.16
179 0.17
180 0.2
181 0.2
182 0.18
183 0.18
184 0.14
185 0.11
186 0.11
187 0.1
188 0.07
189 0.08
190 0.08
191 0.1
192 0.09
193 0.09
194 0.11
195 0.12
196 0.17
197 0.19
198 0.22
199 0.25
200 0.27
201 0.29
202 0.28
203 0.31
204 0.27
205 0.26
206 0.23
207 0.26
208 0.23
209 0.22
210 0.2
211 0.17
212 0.14
213 0.13
214 0.12
215 0.04
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.05
223 0.04
224 0.07
225 0.07
226 0.08
227 0.14
228 0.15
229 0.15
230 0.19
231 0.23
232 0.24
233 0.24
234 0.26
235 0.21
236 0.26
237 0.34
238 0.33
239 0.4
240 0.46
241 0.51
242 0.55
243 0.6
244 0.55
245 0.49
246 0.53
247 0.5
248 0.46
249 0.41
250 0.41
251 0.4
252 0.39
253 0.37
254 0.31
255 0.24
256 0.19
257 0.18
258 0.15
259 0.13
260 0.14
261 0.18
262 0.19
263 0.18
264 0.19
265 0.18
266 0.16
267 0.21
268 0.21
269 0.18
270 0.18
271 0.19
272 0.19
273 0.19
274 0.17
275 0.13
276 0.12
277 0.13
278 0.13
279 0.13
280 0.13
281 0.13
282 0.14
283 0.15
284 0.14
285 0.13
286 0.13
287 0.2
288 0.27
289 0.36
290 0.42
291 0.44
292 0.46
293 0.51
294 0.51
295 0.44
296 0.39
297 0.35
298 0.31
299 0.28
300 0.29
301 0.25
302 0.26
303 0.3
304 0.3
305 0.31
306 0.36
307 0.41
308 0.44
309 0.44
310 0.47
311 0.45
312 0.42
313 0.42
314 0.37
315 0.31
316 0.31
317 0.31
318 0.26
319 0.25
320 0.25
321 0.17
322 0.18
323 0.15
324 0.11
325 0.09
326 0.09
327 0.09
328 0.09
329 0.1
330 0.11
331 0.14