Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08I43

Protein Details
Accession Q08I43   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-72LSTNGNKEKLKRRWKFREKRLEEKRKQERYQKFSTSHydrophilic
NLS Segment(s)
PositionSequence
43-63KEKLKRRWKFREKRLEEKRKQ
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047201  ERI-1_3'hExo-like  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
IPR003034  SAP_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0003725  F:double-stranded RNA binding  
GO:0032296  F:double-stranded RNA-specific ribonuclease activity  
GO:0046872  F:metal ion binding  
GO:0000467  P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0060906  P:negative regulation of small non-coding RNA-mediated heterochromatin formation  
GO:0031047  P:RNA-mediated gene silencing  
Pfam View protein in Pfam  
PF00929  RNase_T  
PROSITE View protein in PROSITE  
PS50800  SAP  
CDD cd06133  ERI-1_3'hExo_like  
Amino Acid Sequences MESPVQILVWPFPCDEMNQKTPSTVEEIRIALQELGLSTNGNKEKLKRRWKFREKRLEEKRKQERYQKFSTSNENKTCLRYLLIVDVEATCEEGCGFSFENEIIELPCLLFDLIEKSIIDEFHSYVRPSMNPTLSDYCKSLTGIQQCTVDKAPIFSDVLEELFIFLRKHSNILVPSVDEIEIIEPLKSVPRTQPKNWAWACDGPWDMASFLAKQFKYDKMPIPDWIKGPFVDIRSFYKDVYRVPRTNINGMLEHWGLQFEGSEHRGIDDARNLSRIVKKMCSENVEFECNRWWMEYEKNGWIPNRSYPPYFAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.31
4 0.34
5 0.36
6 0.36
7 0.35
8 0.35
9 0.34
10 0.34
11 0.29
12 0.25
13 0.26
14 0.27
15 0.27
16 0.27
17 0.27
18 0.19
19 0.17
20 0.14
21 0.11
22 0.11
23 0.1
24 0.09
25 0.08
26 0.16
27 0.18
28 0.21
29 0.23
30 0.3
31 0.4
32 0.5
33 0.61
34 0.63
35 0.71
36 0.79
37 0.88
38 0.91
39 0.91
40 0.93
41 0.9
42 0.92
43 0.92
44 0.92
45 0.89
46 0.89
47 0.89
48 0.88
49 0.88
50 0.87
51 0.86
52 0.82
53 0.82
54 0.8
55 0.74
56 0.68
57 0.71
58 0.69
59 0.68
60 0.65
61 0.61
62 0.54
63 0.52
64 0.49
65 0.39
66 0.32
67 0.24
68 0.21
69 0.21
70 0.2
71 0.17
72 0.16
73 0.14
74 0.14
75 0.12
76 0.12
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.06
83 0.07
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.07
100 0.07
101 0.08
102 0.08
103 0.09
104 0.1
105 0.1
106 0.11
107 0.09
108 0.1
109 0.11
110 0.13
111 0.12
112 0.12
113 0.14
114 0.13
115 0.16
116 0.2
117 0.19
118 0.18
119 0.22
120 0.26
121 0.26
122 0.27
123 0.23
124 0.2
125 0.19
126 0.19
127 0.16
128 0.16
129 0.2
130 0.2
131 0.21
132 0.24
133 0.23
134 0.25
135 0.24
136 0.2
137 0.15
138 0.13
139 0.12
140 0.1
141 0.1
142 0.08
143 0.08
144 0.07
145 0.08
146 0.07
147 0.06
148 0.05
149 0.05
150 0.07
151 0.06
152 0.06
153 0.09
154 0.09
155 0.1
156 0.11
157 0.14
158 0.14
159 0.16
160 0.16
161 0.13
162 0.13
163 0.13
164 0.12
165 0.08
166 0.08
167 0.06
168 0.06
169 0.06
170 0.05
171 0.05
172 0.05
173 0.08
174 0.09
175 0.1
176 0.16
177 0.26
178 0.32
179 0.34
180 0.45
181 0.44
182 0.53
183 0.53
184 0.49
185 0.43
186 0.4
187 0.39
188 0.32
189 0.31
190 0.22
191 0.21
192 0.18
193 0.15
194 0.12
195 0.12
196 0.08
197 0.1
198 0.16
199 0.15
200 0.17
201 0.2
202 0.23
203 0.28
204 0.32
205 0.37
206 0.37
207 0.39
208 0.44
209 0.46
210 0.45
211 0.41
212 0.39
213 0.34
214 0.27
215 0.28
216 0.25
217 0.22
218 0.21
219 0.22
220 0.24
221 0.29
222 0.3
223 0.28
224 0.29
225 0.29
226 0.32
227 0.39
228 0.42
229 0.39
230 0.42
231 0.49
232 0.49
233 0.51
234 0.5
235 0.43
236 0.36
237 0.35
238 0.35
239 0.28
240 0.25
241 0.2
242 0.16
243 0.13
244 0.12
245 0.11
246 0.07
247 0.12
248 0.12
249 0.13
250 0.13
251 0.13
252 0.15
253 0.15
254 0.18
255 0.2
256 0.22
257 0.22
258 0.24
259 0.24
260 0.28
261 0.33
262 0.36
263 0.35
264 0.37
265 0.38
266 0.44
267 0.49
268 0.5
269 0.48
270 0.49
271 0.48
272 0.49
273 0.47
274 0.41
275 0.41
276 0.36
277 0.34
278 0.28
279 0.25
280 0.21
281 0.29
282 0.34
283 0.34
284 0.4
285 0.43
286 0.46
287 0.47
288 0.49
289 0.45
290 0.47
291 0.51
292 0.49
293 0.47