Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2EM60

Protein Details
Accession A0A0D2EM60   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-93AAALAKKKKLHEMKKRQLALEHydrophilic
NLS Segment(s)
PositionSequence
78-83KKKKLH
Subcellular Location(s) cyto 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAGLLGGGGEGRGGLLSGITNTLNSTTKGLPIVRGITEPLLDSVDSGGAPDGGKKPAQAQQPQATAQGQDLEAAALAKKKKLHEMKKRQLALEMEEMEMDGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.04
5 0.06
6 0.06
7 0.06
8 0.07
9 0.09
10 0.1
11 0.11
12 0.14
13 0.13
14 0.14
15 0.17
16 0.17
17 0.16
18 0.17
19 0.18
20 0.15
21 0.15
22 0.15
23 0.13
24 0.12
25 0.11
26 0.1
27 0.08
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.07
39 0.08
40 0.08
41 0.08
42 0.11
43 0.16
44 0.22
45 0.25
46 0.29
47 0.33
48 0.36
49 0.36
50 0.36
51 0.31
52 0.25
53 0.22
54 0.18
55 0.12
56 0.1
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.1
64 0.13
65 0.17
66 0.19
67 0.29
68 0.39
69 0.49
70 0.57
71 0.67
72 0.75
73 0.82
74 0.84
75 0.75
76 0.71
77 0.64
78 0.57
79 0.53
80 0.44
81 0.34
82 0.3