Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O59669

Protein Details
Accession O59669    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-28VTPIEHAVQKRKKQKQRSVVDPVTREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039723  Vps71/ZNHIT1  
IPR007529  Znf_HIT  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0000812  C:Swr1 complex  
GO:0046872  F:metal ion binding  
GO:0031491  F:nucleosome binding  
GO:0006338  P:chromatin remodeling  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
KEGG spo:SPBC29A3.05  -  
Pfam View protein in Pfam  
PF04438  zf-HIT  
PROSITE View protein in PROSITE  
PS51083  ZF_HIT  
Amino Acid Sequences MFVTPIEHAVQKRKKQKQRSVVDPVTRERQLKRNLADLEKDNFSDIRFEIPKDLLQRRVLPISVRRILSSRKTFVNYLDETPNSRYNTCVAKPSYKPPRKFCNVCGYWGKYACQNCGTSYCSKGCEVIHSETRCMKVYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.87
4 0.87
5 0.88
6 0.88
7 0.87
8 0.85
9 0.82
10 0.76
11 0.71
12 0.67
13 0.61
14 0.56
15 0.5
16 0.5
17 0.51
18 0.54
19 0.51
20 0.52
21 0.52
22 0.52
23 0.52
24 0.47
25 0.43
26 0.37
27 0.35
28 0.28
29 0.24
30 0.21
31 0.18
32 0.14
33 0.16
34 0.15
35 0.15
36 0.16
37 0.17
38 0.2
39 0.24
40 0.26
41 0.25
42 0.27
43 0.29
44 0.29
45 0.3
46 0.28
47 0.24
48 0.26
49 0.29
50 0.3
51 0.28
52 0.26
53 0.26
54 0.29
55 0.34
56 0.34
57 0.29
58 0.28
59 0.3
60 0.3
61 0.3
62 0.31
63 0.25
64 0.23
65 0.24
66 0.22
67 0.22
68 0.25
69 0.28
70 0.24
71 0.23
72 0.21
73 0.21
74 0.26
75 0.25
76 0.28
77 0.25
78 0.3
79 0.32
80 0.42
81 0.5
82 0.54
83 0.61
84 0.62
85 0.69
86 0.72
87 0.74
88 0.69
89 0.69
90 0.62
91 0.6
92 0.6
93 0.54
94 0.5
95 0.48
96 0.44
97 0.38
98 0.4
99 0.38
100 0.34
101 0.31
102 0.27
103 0.29
104 0.32
105 0.29
106 0.31
107 0.29
108 0.28
109 0.27
110 0.28
111 0.25
112 0.28
113 0.3
114 0.32
115 0.38
116 0.38
117 0.41
118 0.43
119 0.46