Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9UUJ5

Protein Details
Accession Q9UUJ5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-142LSESLKKTSKFKNERQKASKIAKPHydrophilic
NLS Segment(s)
PositionSequence
100-142KGKISERKRDEILENRRLKLSESLKKTSKFKNERQKASKIAKP
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG spo:SPAC1952.14c  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MPVFTKEALERLPIQLGNFFKKFPPENPNAWTTNPNRQNPFLATRNPQNGLVINPYYSNRRQAEIYKEARLQNLDNLLPQQMSWQKDSTRHILKGLLNPKGKISERKRDEILENRRLKLSESLKKTSKFKNERQKASKIAKPSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.28
4 0.31
5 0.3
6 0.29
7 0.27
8 0.33
9 0.35
10 0.36
11 0.41
12 0.4
13 0.43
14 0.46
15 0.49
16 0.45
17 0.43
18 0.44
19 0.4
20 0.45
21 0.48
22 0.5
23 0.5
24 0.49
25 0.5
26 0.47
27 0.5
28 0.43
29 0.4
30 0.39
31 0.41
32 0.44
33 0.42
34 0.39
35 0.33
36 0.3
37 0.26
38 0.25
39 0.19
40 0.15
41 0.14
42 0.15
43 0.18
44 0.19
45 0.24
46 0.22
47 0.23
48 0.25
49 0.27
50 0.33
51 0.36
52 0.38
53 0.34
54 0.37
55 0.36
56 0.35
57 0.33
58 0.26
59 0.2
60 0.2
61 0.16
62 0.13
63 0.12
64 0.12
65 0.1
66 0.09
67 0.11
68 0.13
69 0.15
70 0.17
71 0.18
72 0.2
73 0.24
74 0.28
75 0.31
76 0.33
77 0.32
78 0.31
79 0.34
80 0.35
81 0.38
82 0.41
83 0.41
84 0.38
85 0.38
86 0.38
87 0.39
88 0.4
89 0.42
90 0.44
91 0.46
92 0.49
93 0.54
94 0.55
95 0.53
96 0.57
97 0.57
98 0.58
99 0.58
100 0.57
101 0.54
102 0.54
103 0.5
104 0.46
105 0.45
106 0.45
107 0.44
108 0.46
109 0.51
110 0.56
111 0.61
112 0.65
113 0.65
114 0.67
115 0.67
116 0.7
117 0.75
118 0.78
119 0.83
120 0.84
121 0.83
122 0.82
123 0.81
124 0.76
125 0.74