Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q09678

Protein Details
Accession Q09678    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-35FPAPLEKKEKREKGKIRNISFHydrophilic
NLS Segment(s)
PositionSequence
21-29KKEKREKGK
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 5
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
KEGG spo:SPAC5H10.07  -  
Amino Acid Sequences MTVLTSYKLYCGPDFPAPLEKKEKREKGKIRNISFLIVLTKGPIWKVSSMESTSYNGCIENLDCKFRKSFIEEIIAYEGFGKYIEVINF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.33
4 0.32
5 0.36
6 0.44
7 0.44
8 0.48
9 0.56
10 0.63
11 0.62
12 0.71
13 0.76
14 0.77
15 0.83
16 0.84
17 0.78
18 0.76
19 0.69
20 0.59
21 0.5
22 0.4
23 0.3
24 0.21
25 0.17
26 0.1
27 0.1
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.1
34 0.12
35 0.14
36 0.14
37 0.16
38 0.15
39 0.16
40 0.15
41 0.15
42 0.14
43 0.11
44 0.1
45 0.09
46 0.09
47 0.14
48 0.15
49 0.21
50 0.21
51 0.23
52 0.24
53 0.25
54 0.28
55 0.26
56 0.29
57 0.27
58 0.33
59 0.31
60 0.33
61 0.35
62 0.32
63 0.26
64 0.23
65 0.19
66 0.12
67 0.12
68 0.1
69 0.07