Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q09330

Protein Details
Accession Q09330    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-43IIASKPKGGIRKRRARSNKPKPTKNAKPAVNTHydrophilic
155-188TASKNGAKSSKRKTTRRRRTPNRPKKSAEELDKEHydrophilic
NLS Segment(s)
PositionSequence
16-38KPKGGIRKRRARSNKPKPTKNAK
159-180NGAKSSKRKTTRRRRTPNRPKK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR034357  Yra1/Mlo3_RRM  
Gene Ontology GO:0005634  C:nucleus  
GO:0000346  C:transcription export complex  
GO:0062153  F:C5-methylcytidine-containing RNA binding  
GO:0003729  F:mRNA binding  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
KEGG spo:SPBC1D7.04  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12267  RRM_YRA1_MLO3  
Amino Acid Sequences MSMELDQSLDAIIASKPKGGIRKRRARSNKPKPTKNAKPAVNTASALKSVISEESKIIVSNLPTDVTEAQVKELFVKSIGPCKRVSLAYGPNGRSKGIATIIFSRPGDATRAYEQYEGRLVDGTRKMKVEIILDPSRQLNSLAARVSPASNASATASKNGAKSSKRKTTRRRRTPNRPKKSAEELDKEMDDYFGSNEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.18
5 0.27
6 0.35
7 0.45
8 0.52
9 0.63
10 0.69
11 0.79
12 0.86
13 0.88
14 0.91
15 0.91
16 0.92
17 0.92
18 0.93
19 0.91
20 0.92
21 0.91
22 0.89
23 0.87
24 0.82
25 0.78
26 0.75
27 0.69
28 0.62
29 0.52
30 0.44
31 0.36
32 0.3
33 0.24
34 0.18
35 0.14
36 0.11
37 0.13
38 0.12
39 0.11
40 0.11
41 0.13
42 0.13
43 0.12
44 0.12
45 0.11
46 0.1
47 0.11
48 0.11
49 0.1
50 0.1
51 0.11
52 0.11
53 0.11
54 0.13
55 0.11
56 0.12
57 0.13
58 0.13
59 0.13
60 0.13
61 0.12
62 0.1
63 0.12
64 0.12
65 0.19
66 0.21
67 0.21
68 0.21
69 0.22
70 0.25
71 0.23
72 0.24
73 0.21
74 0.23
75 0.28
76 0.33
77 0.33
78 0.33
79 0.33
80 0.32
81 0.26
82 0.22
83 0.17
84 0.14
85 0.13
86 0.11
87 0.15
88 0.16
89 0.18
90 0.18
91 0.17
92 0.15
93 0.14
94 0.15
95 0.11
96 0.13
97 0.13
98 0.15
99 0.16
100 0.18
101 0.17
102 0.17
103 0.19
104 0.16
105 0.14
106 0.14
107 0.13
108 0.16
109 0.22
110 0.22
111 0.21
112 0.22
113 0.22
114 0.22
115 0.24
116 0.21
117 0.18
118 0.24
119 0.25
120 0.25
121 0.26
122 0.25
123 0.23
124 0.21
125 0.19
126 0.14
127 0.13
128 0.16
129 0.15
130 0.14
131 0.15
132 0.15
133 0.15
134 0.13
135 0.12
136 0.1
137 0.1
138 0.1
139 0.11
140 0.14
141 0.14
142 0.15
143 0.16
144 0.17
145 0.18
146 0.21
147 0.25
148 0.28
149 0.36
150 0.44
151 0.52
152 0.6
153 0.69
154 0.77
155 0.82
156 0.88
157 0.91
158 0.93
159 0.93
160 0.95
161 0.97
162 0.97
163 0.96
164 0.94
165 0.89
166 0.85
167 0.85
168 0.83
169 0.81
170 0.77
171 0.71
172 0.67
173 0.61
174 0.54
175 0.44
176 0.35
177 0.25
178 0.19
179 0.16