Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O14041

Protein Details
Accession O14041    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-51LTPEEVKAERKERKRRAAIQRAEKKLIRBasic
NLS Segment(s)
PositionSequence
18-53KRIRYKLTPEEVKAERKERKRRAAIQRAEKKLIRAK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0090304  P:nucleic acid metabolic process  
KEGG spo:SPAC2C4.08  -  
Amino Acid Sequences MNRLQAKKAVNVSRHEQKRIRYKLTPEEVKAERKERKRRAAIQRAEKKLIRAKGEALVAFQAVSNPSCNFLVIDFEAYEFNQKIITEAGITMRINGEWDYHHYRIKNFLHLRNGRFVPDEADNFQFGDSKIVTKIAFISILKKILKTPNLHLVGHGVENEIKYANVLGIPIPKDVTVLDTQNVFSFFQSLFLKEISNSNNISLAKMLTHLNIRAFCLHNAGNDARYTSEALREMTNKFTLSNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.64
4 0.65
5 0.7
6 0.74
7 0.73
8 0.7
9 0.71
10 0.73
11 0.77
12 0.76
13 0.68
14 0.66
15 0.64
16 0.64
17 0.63
18 0.62
19 0.61
20 0.63
21 0.71
22 0.74
23 0.79
24 0.81
25 0.85
26 0.87
27 0.89
28 0.89
29 0.89
30 0.89
31 0.85
32 0.82
33 0.73
34 0.69
35 0.66
36 0.62
37 0.55
38 0.47
39 0.43
40 0.4
41 0.42
42 0.36
43 0.29
44 0.23
45 0.19
46 0.17
47 0.14
48 0.11
49 0.09
50 0.09
51 0.1
52 0.1
53 0.12
54 0.12
55 0.12
56 0.11
57 0.1
58 0.12
59 0.11
60 0.12
61 0.1
62 0.1
63 0.11
64 0.1
65 0.13
66 0.1
67 0.1
68 0.1
69 0.09
70 0.1
71 0.1
72 0.1
73 0.07
74 0.07
75 0.08
76 0.1
77 0.1
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.09
84 0.07
85 0.13
86 0.19
87 0.2
88 0.23
89 0.23
90 0.24
91 0.32
92 0.32
93 0.36
94 0.35
95 0.38
96 0.45
97 0.49
98 0.5
99 0.47
100 0.46
101 0.38
102 0.34
103 0.3
104 0.23
105 0.2
106 0.19
107 0.16
108 0.16
109 0.15
110 0.14
111 0.13
112 0.12
113 0.1
114 0.11
115 0.09
116 0.08
117 0.08
118 0.1
119 0.1
120 0.09
121 0.09
122 0.08
123 0.09
124 0.08
125 0.11
126 0.11
127 0.16
128 0.16
129 0.16
130 0.19
131 0.23
132 0.28
133 0.28
134 0.31
135 0.35
136 0.38
137 0.38
138 0.35
139 0.31
140 0.26
141 0.24
142 0.2
143 0.12
144 0.09
145 0.1
146 0.1
147 0.08
148 0.07
149 0.07
150 0.07
151 0.06
152 0.05
153 0.05
154 0.06
155 0.09
156 0.1
157 0.11
158 0.11
159 0.11
160 0.11
161 0.11
162 0.13
163 0.12
164 0.12
165 0.13
166 0.13
167 0.14
168 0.15
169 0.16
170 0.13
171 0.11
172 0.11
173 0.1
174 0.14
175 0.15
176 0.15
177 0.15
178 0.15
179 0.16
180 0.14
181 0.19
182 0.17
183 0.2
184 0.2
185 0.19
186 0.23
187 0.23
188 0.23
189 0.19
190 0.17
191 0.13
192 0.14
193 0.15
194 0.12
195 0.16
196 0.17
197 0.21
198 0.22
199 0.23
200 0.26
201 0.28
202 0.26
203 0.27
204 0.26
205 0.23
206 0.27
207 0.27
208 0.25
209 0.23
210 0.23
211 0.2
212 0.2
213 0.21
214 0.17
215 0.21
216 0.21
217 0.21
218 0.24
219 0.26
220 0.27
221 0.29
222 0.3
223 0.26