Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13984

Protein Details
Accession O13984   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-89EPEPSPTKKTKLTRRDTRPLAERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR032423  AAA_assoc_2  
IPR003959  ATPase_AAA_core  
IPR008921  DNA_pol3_clamp-load_cplx_C  
IPR021886  MgsA_C  
IPR027417  P-loop_NTPase  
IPR006642  Rad18_UBZ4  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0008047  F:enzyme activator activity  
GO:0046872  F:metal ion binding  
GO:0017116  F:single-stranded DNA helicase activity  
GO:0000731  P:DNA synthesis involved in DNA repair  
GO:0006261  P:DNA-templated DNA replication  
GO:1903461  P:Okazaki fragment processing involved in mitotic DNA replication  
GO:0070914  P:UV-damage excision repair  
KEGG spo:SPAC26H5.02c  -  
Pfam View protein in Pfam  
PF00004  AAA  
PF16193  AAA_assoc_2  
PF12002  MgsA_C  
PROSITE View protein in PROSITE  
PS51908  ZF_UBZ4  
CDD cd00009  AAA  
cd18139  HLD_clamp_RarA  
Amino Acid Sequences MSGPDHVQCPVCAKTVTMNDINPHLDSHYSDSSGPSKPVSPFFKKERYKHHLETNVSSHQSATKFIEPEPSPTKKTKLTRRDTRPLAERARPKSLDEYVGQEELVGERGIIRNLIEQDRCNSMILWGSAGTGKTTLARLIAVTTKSRFIEISATSTTVADCRKIFEDSQNYLTLTGRKTIIFLDEVHRFNRAQQDIFLPMVEKGLVTLIGATTENPSFRLNSALISRCPVFVLKKLTRDNVKKILNHACLLESERLGSSMPNVETSIIDYISAITDGDARMALNALEMSIGMLRQGPLSLEDIKDKLVRSSALYDRVGDVHYDTISAFHKSVRGSDVDATLYYLGRMLESGEDPLYVARRMVRIASEDIGIADNSMLPLASSTFTAVQQVGMPEADVILAHCAVALALAPKSVDVYRSYNAVKSFLSSHPDAGRAEIPMHIRNAPTNLMKQLGYHKGYKYNPDYKDGLVMQEYLPDSIKGTKFYKLPIELKEDEEIKNLKTDTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.37
4 0.36
5 0.36
6 0.36
7 0.39
8 0.4
9 0.34
10 0.29
11 0.24
12 0.21
13 0.21
14 0.25
15 0.23
16 0.23
17 0.23
18 0.26
19 0.28
20 0.3
21 0.29
22 0.25
23 0.26
24 0.28
25 0.36
26 0.41
27 0.45
28 0.49
29 0.56
30 0.64
31 0.69
32 0.73
33 0.76
34 0.76
35 0.77
36 0.76
37 0.78
38 0.76
39 0.72
40 0.71
41 0.66
42 0.66
43 0.58
44 0.52
45 0.42
46 0.39
47 0.34
48 0.31
49 0.3
50 0.28
51 0.28
52 0.28
53 0.36
54 0.33
55 0.39
56 0.43
57 0.43
58 0.42
59 0.45
60 0.5
61 0.49
62 0.58
63 0.61
64 0.64
65 0.7
66 0.76
67 0.81
68 0.86
69 0.84
70 0.83
71 0.8
72 0.78
73 0.75
74 0.73
75 0.72
76 0.68
77 0.7
78 0.63
79 0.58
80 0.56
81 0.51
82 0.47
83 0.4
84 0.39
85 0.33
86 0.32
87 0.29
88 0.22
89 0.19
90 0.15
91 0.15
92 0.1
93 0.06
94 0.07
95 0.09
96 0.09
97 0.1
98 0.1
99 0.12
100 0.16
101 0.21
102 0.22
103 0.22
104 0.24
105 0.28
106 0.28
107 0.25
108 0.22
109 0.18
110 0.19
111 0.18
112 0.16
113 0.12
114 0.11
115 0.12
116 0.12
117 0.12
118 0.09
119 0.09
120 0.09
121 0.1
122 0.1
123 0.08
124 0.09
125 0.08
126 0.1
127 0.13
128 0.14
129 0.17
130 0.17
131 0.2
132 0.21
133 0.21
134 0.19
135 0.17
136 0.2
137 0.17
138 0.2
139 0.18
140 0.18
141 0.18
142 0.18
143 0.17
144 0.14
145 0.14
146 0.13
147 0.12
148 0.14
149 0.15
150 0.18
151 0.19
152 0.23
153 0.29
154 0.3
155 0.33
156 0.32
157 0.3
158 0.28
159 0.28
160 0.25
161 0.18
162 0.18
163 0.16
164 0.14
165 0.15
166 0.15
167 0.15
168 0.13
169 0.13
170 0.15
171 0.2
172 0.22
173 0.21
174 0.23
175 0.21
176 0.22
177 0.29
178 0.27
179 0.22
180 0.22
181 0.24
182 0.24
183 0.24
184 0.21
185 0.14
186 0.12
187 0.11
188 0.1
189 0.07
190 0.05
191 0.05
192 0.05
193 0.04
194 0.04
195 0.03
196 0.04
197 0.04
198 0.05
199 0.06
200 0.07
201 0.07
202 0.08
203 0.09
204 0.09
205 0.1
206 0.12
207 0.1
208 0.11
209 0.15
210 0.16
211 0.16
212 0.18
213 0.18
214 0.15
215 0.16
216 0.16
217 0.13
218 0.15
219 0.23
220 0.24
221 0.31
222 0.33
223 0.37
224 0.44
225 0.47
226 0.49
227 0.49
228 0.51
229 0.45
230 0.48
231 0.52
232 0.46
233 0.42
234 0.36
235 0.28
236 0.24
237 0.25
238 0.2
239 0.12
240 0.1
241 0.09
242 0.09
243 0.09
244 0.08
245 0.06
246 0.08
247 0.09
248 0.09
249 0.09
250 0.09
251 0.09
252 0.1
253 0.1
254 0.07
255 0.06
256 0.06
257 0.06
258 0.05
259 0.05
260 0.04
261 0.03
262 0.04
263 0.04
264 0.05
265 0.05
266 0.04
267 0.04
268 0.05
269 0.04
270 0.04
271 0.04
272 0.03
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.04
280 0.04
281 0.04
282 0.05
283 0.05
284 0.06
285 0.08
286 0.1
287 0.1
288 0.11
289 0.12
290 0.13
291 0.15
292 0.14
293 0.13
294 0.13
295 0.13
296 0.13
297 0.18
298 0.19
299 0.23
300 0.23
301 0.22
302 0.22
303 0.22
304 0.2
305 0.15
306 0.13
307 0.09
308 0.09
309 0.08
310 0.07
311 0.09
312 0.1
313 0.11
314 0.1
315 0.1
316 0.13
317 0.13
318 0.14
319 0.15
320 0.14
321 0.15
322 0.16
323 0.17
324 0.15
325 0.15
326 0.14
327 0.12
328 0.11
329 0.09
330 0.08
331 0.07
332 0.06
333 0.06
334 0.06
335 0.07
336 0.07
337 0.09
338 0.08
339 0.08
340 0.08
341 0.09
342 0.1
343 0.09
344 0.09
345 0.1
346 0.11
347 0.12
348 0.13
349 0.13
350 0.14
351 0.17
352 0.17
353 0.15
354 0.14
355 0.14
356 0.14
357 0.12
358 0.09
359 0.07
360 0.06
361 0.05
362 0.05
363 0.04
364 0.03
365 0.04
366 0.05
367 0.05
368 0.05
369 0.07
370 0.08
371 0.09
372 0.1
373 0.1
374 0.1
375 0.11
376 0.11
377 0.11
378 0.09
379 0.09
380 0.07
381 0.07
382 0.07
383 0.05
384 0.05
385 0.05
386 0.05
387 0.05
388 0.05
389 0.05
390 0.05
391 0.05
392 0.05
393 0.05
394 0.05
395 0.06
396 0.06
397 0.06
398 0.09
399 0.09
400 0.11
401 0.13
402 0.17
403 0.18
404 0.22
405 0.24
406 0.25
407 0.26
408 0.27
409 0.23
410 0.21
411 0.24
412 0.23
413 0.27
414 0.25
415 0.28
416 0.27
417 0.3
418 0.28
419 0.27
420 0.25
421 0.21
422 0.21
423 0.2
424 0.22
425 0.22
426 0.25
427 0.24
428 0.24
429 0.25
430 0.27
431 0.29
432 0.29
433 0.29
434 0.29
435 0.3
436 0.29
437 0.28
438 0.33
439 0.37
440 0.37
441 0.38
442 0.39
443 0.45
444 0.49
445 0.56
446 0.57
447 0.57
448 0.56
449 0.57
450 0.56
451 0.48
452 0.52
453 0.43
454 0.37
455 0.3
456 0.28
457 0.23
458 0.25
459 0.25
460 0.19
461 0.19
462 0.16
463 0.17
464 0.23
465 0.25
466 0.25
467 0.27
468 0.31
469 0.32
470 0.37
471 0.43
472 0.44
473 0.48
474 0.47
475 0.53
476 0.5
477 0.51
478 0.52
479 0.47
480 0.4
481 0.4
482 0.37
483 0.31
484 0.34