FuNGI

O13984

Protein Details

Accession

O13984

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
67-89	EPEPSPTKKTKLTRRDTRPLAER	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16, cyto_nucl 13.5, cyto 9

Family & Domain DBs

InterPro	View protein in InterPro IPR003593 AAA+_ATPase IPR032423 AAA_assoc_2 IPR003959 ATPase_AAA_core IPR008921 DNA_pol3_clamp-load_cplx_C IPR021886 MgsA_C IPR027417 P-loop_NTPase IPR006642 Rad18_UBZ4
Gene Ontology	GO:0005634 C:nucleus GO:0005524 F:ATP binding GO:0016887 F:ATP hydrolysis activity GO:0003677 F:DNA binding GO:0008047 F:enzyme activator activity GO:0046872 F:metal ion binding GO:0017116 F:single-stranded DNA helicase activity GO:0000731 P:DNA synthesis involved in DNA repair GO:0006261 P:DNA-templated DNA replication GO:1903461 P:Okazaki fragment processing involved in mitotic DNA replication GO:0070914 P:UV-damage excision repair
KEGG	spo:SPAC26H5.02c -
Pfam	View protein in Pfam PF00004 AAA PF16193 AAA_assoc_2 PF12002 MgsA_C
PROSITE	View protein in PROSITE PS51908 ZF_UBZ4
CDD	cd00009 AAA cd18139 HLD_clamp_RarA

Amino Acid Sequences

MSGPDHVQCPVCAKTVTMNDINPHLDSHYSDSSGPSKPVSPFFKKERYKHHLETNVSSHQSATKFIEPEPSPTKKTKLTRRDTRPLAERARPKSLDEYVGQEELVGERGIIRNLIEQDRCNSMILWGSAGTGKTTLARLIAVTTKSRFIEISATSTTVADCRKIFEDSQNYLTLTGRKTIIFLDEVHRFNRAQQDIFLPMVEKGLVTLIGATTENPSFRLNSALISRCPVFVLKKLTRDNVKKILNHACLLESERLGSSMPNVETSIIDYISAITDGDARMALNALEMSIGMLRQGPLSLEDIKDKLVRSSALYDRVGDVHYDTISAFHKSVRGSDVDATLYYLGRMLESGEDPLYVARRMVRIASEDIGIADNSMLPLASSTFTAVQQVGMPEADVILAHCAVALALAPKSVDVYRSYNAVKSFLSSHPDAGRAEIPMHIRNAPTNLMKQLGYHKGYKYNPDYKDGLVMQEYLPDSIKGTKFYKLPIELKEDEEIKNLKTDTK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.32
3	0.37
4	0.36
5	0.36
6	0.36
7	0.39
8	0.4
9	0.34
10	0.29
11	0.24
12	0.21
13	0.21
14	0.25
15	0.23
16	0.23
17	0.23
18	0.26
19	0.28
20	0.3
21	0.29
22	0.25
23	0.26
24	0.28
25	0.36
26	0.41
27	0.45
28	0.49
29	0.56
30	0.64
31	0.69
32	0.73
33	0.76
34	0.76
35	0.77
36	0.76
37	0.78
38	0.76
39	0.72
40	0.71
41	0.66
42	0.66
43	0.58
44	0.52
45	0.42
46	0.39
47	0.34
48	0.31
49	0.3
50	0.28
51	0.28
52	0.28
53	0.36
54	0.33
55	0.39
56	0.43
57	0.43
58	0.42
59	0.45
60	0.5
61	0.49
62	0.58
63	0.61
64	0.64
65	0.7
66	0.76
67	0.81
68	0.86
69	0.84
70	0.83
71	0.8
72	0.78
73	0.75
74	0.73
75	0.72
76	0.68
77	0.7
78	0.63
79	0.58
80	0.56
81	0.51
82	0.47
83	0.4
84	0.39
85	0.33
86	0.32
87	0.29
88	0.22
89	0.19
90	0.15
91	0.15
92	0.1
93	0.06
94	0.07
95	0.09
96	0.09
97	0.1
98	0.1
99	0.12
100	0.16
101	0.21
102	0.22
103	0.22
104	0.24
105	0.28
106	0.28
107	0.25
108	0.22
109	0.18
110	0.19
111	0.18
112	0.16
113	0.12
114	0.11
115	0.12
116	0.12
117	0.12
118	0.09
119	0.09
120	0.09
121	0.1
122	0.1
123	0.08
124	0.09
125	0.08
126	0.1
127	0.13
128	0.14
129	0.17
130	0.17
131	0.2
132	0.21
133	0.21
134	0.19
135	0.17
136	0.2
137	0.17
138	0.2
139	0.18
140	0.18
141	0.18
142	0.18
143	0.17
144	0.14
145	0.14
146	0.13
147	0.12
148	0.14
149	0.15
150	0.18
151	0.19
152	0.23
153	0.29
154	0.3
155	0.33
156	0.32
157	0.3
158	0.28
159	0.28
160	0.25
161	0.18
162	0.18
163	0.16
164	0.14
165	0.15
166	0.15
167	0.15
168	0.13
169	0.13
170	0.15
171	0.2
172	0.22
173	0.21
174	0.23
175	0.21
176	0.22
177	0.29
178	0.27
179	0.22
180	0.22
181	0.24
182	0.24
183	0.24
184	0.21
185	0.14
186	0.12
187	0.11
188	0.1
189	0.07
190	0.05
191	0.05
192	0.05
193	0.04
194	0.04
195	0.03
196	0.04
197	0.04
198	0.05
199	0.06
200	0.07
201	0.07
202	0.08
203	0.09
204	0.09
205	0.1
206	0.12
207	0.1
208	0.11
209	0.15
210	0.16
211	0.16
212	0.18
213	0.18
214	0.15
215	0.16
216	0.16
217	0.13
218	0.15
219	0.23
220	0.24
221	0.31
222	0.33
223	0.37
224	0.44
225	0.47
226	0.49
227	0.49
228	0.51
229	0.45
230	0.48
231	0.52
232	0.46
233	0.42
234	0.36
235	0.28
236	0.24
237	0.25
238	0.2
239	0.12
240	0.1
241	0.09
242	0.09
243	0.09
244	0.08
245	0.06
246	0.08
247	0.09
248	0.09
249	0.09
250	0.09
251	0.09
252	0.1
253	0.1
254	0.07
255	0.06
256	0.06
257	0.06
258	0.05
259	0.05
260	0.04
261	0.03
262	0.04
263	0.04
264	0.05
265	0.05
266	0.04
267	0.04
268	0.05
269	0.04
270	0.04
271	0.04
272	0.03
273	0.03
274	0.03
275	0.03
276	0.03
277	0.03
278	0.03
279	0.04
280	0.04
281	0.04
282	0.05
283	0.05
284	0.06
285	0.08
286	0.1
287	0.1
288	0.11
289	0.12
290	0.13
291	0.15
292	0.14
293	0.13
294	0.13
295	0.13
296	0.13
297	0.18
298	0.19
299	0.23
300	0.23
301	0.22
302	0.22
303	0.22
304	0.2
305	0.15
306	0.13
307	0.09
308	0.09
309	0.08
310	0.07
311	0.09
312	0.1
313	0.11
314	0.1
315	0.1
316	0.13
317	0.13
318	0.14
319	0.15
320	0.14
321	0.15
322	0.16
323	0.17
324	0.15
325	0.15
326	0.14
327	0.12
328	0.11
329	0.09
330	0.08
331	0.07
332	0.06
333	0.06
334	0.06
335	0.07
336	0.07
337	0.09
338	0.08
339	0.08
340	0.08
341	0.09
342	0.1
343	0.09
344	0.09
345	0.1
346	0.11
347	0.12
348	0.13
349	0.13
350	0.14
351	0.17
352	0.17
353	0.15
354	0.14
355	0.14
356	0.14
357	0.12
358	0.09
359	0.07
360	0.06
361	0.05
362	0.05
363	0.04
364	0.03
365	0.04
366	0.05
367	0.05
368	0.05
369	0.07
370	0.08
371	0.09
372	0.1
373	0.1
374	0.1
375	0.11
376	0.11
377	0.11
378	0.09
379	0.09
380	0.07
381	0.07
382	0.07
383	0.05
384	0.05
385	0.05
386	0.05
387	0.05
388	0.05
389	0.05
390	0.05
391	0.05
392	0.05
393	0.05
394	0.05
395	0.06
396	0.06
397	0.06
398	0.09
399	0.09
400	0.11
401	0.13
402	0.17
403	0.18
404	0.22
405	0.24
406	0.25
407	0.26
408	0.27
409	0.23
410	0.21
411	0.24
412	0.23
413	0.27
414	0.25
415	0.28
416	0.27
417	0.3
418	0.28
419	0.27
420	0.25
421	0.21
422	0.21
423	0.2
424	0.22
425	0.22
426	0.25
427	0.24
428	0.24
429	0.25
430	0.27
431	0.29
432	0.29
433	0.29
434	0.29
435	0.3
436	0.29
437	0.28
438	0.33
439	0.37
440	0.37
441	0.38
442	0.39
443	0.45
444	0.49
445	0.56
446	0.57
447	0.57
448	0.56
449	0.57
450	0.56
451	0.48
452	0.52
453	0.43
454	0.37
455	0.3
456	0.28
457	0.23
458	0.25
459	0.25
460	0.19
461	0.19
462	0.16
463	0.17
464	0.23
465	0.25
466	0.25
467	0.27
468	0.31
469	0.32
470	0.37
471	0.43
472	0.44
473	0.48
474	0.47
475	0.53
476	0.5
477	0.51
478	0.52
479	0.47
480	0.4
481	0.4
482	0.37
483	0.31
484	0.34

O13984

3D AlphaFold-predicted Structure Viewer