Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O13787

Protein Details
Accession O13787    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
216-246LWSWHNSKSEVKKTRKSKKLSKKATSPAASAHydrophilic
NLS Segment(s)
PositionSequence
226-239VKKTRKSKKLSKKA
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004728  Sec62  
IPR011553  Sec62_asco  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0031207  C:Sec62/Sec63 complex  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
KEGG spo:SPAC17G6.09  -  
Pfam View protein in Pfam  
PF03839  Sec62  
Amino Acid Sequences MDSSNVPVLKDEDKCKFSMRFTNFLKSRPELKTKPAILNGKRVYYFRVKRVLRFLTSEAYTPKKYKGFPEISSREEAIEVLKLLIMNSMLVRVDKLPPKQRKQKLVELQINRNQDFQDDMHYVWLYEPLPKRVMALAVLFALVVLALVLFPLWPMFMRKGAWYLSMGGLGVIGLFFVLVILRFFLFCITAVIVRPGIWLFPNLLADVGFCDSFKPLWSWHNSKSEVKKTRKSKKLSKKATSPAASATPEKSSTSTTSLKNLRHRNPTVEEVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.45
4 0.44
5 0.49
6 0.48
7 0.49
8 0.51
9 0.6
10 0.57
11 0.58
12 0.59
13 0.54
14 0.56
15 0.54
16 0.59
17 0.52
18 0.56
19 0.61
20 0.6
21 0.62
22 0.62
23 0.65
24 0.59
25 0.65
26 0.62
27 0.58
28 0.54
29 0.49
30 0.46
31 0.47
32 0.5
33 0.46
34 0.53
35 0.5
36 0.53
37 0.61
38 0.61
39 0.54
40 0.52
41 0.47
42 0.43
43 0.41
44 0.38
45 0.33
46 0.33
47 0.33
48 0.31
49 0.34
50 0.33
51 0.35
52 0.37
53 0.43
54 0.44
55 0.44
56 0.53
57 0.52
58 0.5
59 0.51
60 0.46
61 0.37
62 0.31
63 0.27
64 0.17
65 0.14
66 0.11
67 0.08
68 0.08
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.12
81 0.17
82 0.24
83 0.33
84 0.42
85 0.52
86 0.61
87 0.68
88 0.73
89 0.74
90 0.77
91 0.76
92 0.77
93 0.76
94 0.72
95 0.71
96 0.67
97 0.66
98 0.56
99 0.48
100 0.38
101 0.3
102 0.27
103 0.19
104 0.18
105 0.14
106 0.13
107 0.14
108 0.14
109 0.13
110 0.11
111 0.13
112 0.09
113 0.13
114 0.14
115 0.15
116 0.17
117 0.16
118 0.17
119 0.15
120 0.16
121 0.11
122 0.1
123 0.08
124 0.07
125 0.07
126 0.06
127 0.05
128 0.04
129 0.03
130 0.02
131 0.02
132 0.01
133 0.01
134 0.01
135 0.01
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.05
142 0.06
143 0.08
144 0.09
145 0.1
146 0.12
147 0.13
148 0.14
149 0.13
150 0.13
151 0.12
152 0.11
153 0.1
154 0.08
155 0.07
156 0.05
157 0.04
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.03
168 0.04
169 0.04
170 0.04
171 0.04
172 0.05
173 0.05
174 0.06
175 0.07
176 0.08
177 0.08
178 0.09
179 0.09
180 0.09
181 0.1
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.1
188 0.11
189 0.1
190 0.1
191 0.09
192 0.09
193 0.09
194 0.09
195 0.08
196 0.07
197 0.08
198 0.08
199 0.09
200 0.1
201 0.11
202 0.12
203 0.18
204 0.26
205 0.31
206 0.37
207 0.44
208 0.48
209 0.54
210 0.61
211 0.65
212 0.67
213 0.7
214 0.73
215 0.76
216 0.82
217 0.84
218 0.84
219 0.84
220 0.86
221 0.88
222 0.9
223 0.88
224 0.88
225 0.88
226 0.88
227 0.81
228 0.71
229 0.64
230 0.58
231 0.52
232 0.44
233 0.38
234 0.31
235 0.29
236 0.29
237 0.27
238 0.25
239 0.25
240 0.29
241 0.32
242 0.31
243 0.38
244 0.43
245 0.49
246 0.55
247 0.62
248 0.65
249 0.69
250 0.72
251 0.71
252 0.7
253 0.7