Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9UUI2

Protein Details
Accession Q9UUI2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-52ESSYRSRQSYHQRTKTPRSSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Gene Ontology GO:0005829  C:cytosol  
GO:0033503  C:HULC complex  
GO:0005634  C:nucleus  
GO:0005816  C:spindle pole body  
GO:0040029  P:epigenetic regulation of gene expression  
GO:0140673  P:transcription elongation-coupled chromatin remodeling  
KEGG spo:SPAC22F8.12c  -  
Pfam View protein in Pfam  
PF11488  Lge1  
Amino Acid Sequences MSSRRNDYHYDGNDHQYRSPLKSNVDQNSFYESSYRSRQSYHQRTKTPRSSYDSPSSSTNSKEHNSPYHYRVPSNNSTRASFGAASTDTNVELPKINLPDSSLSSKLQSCKSACENSSQSLLNVEQQYAQQVHFWEKIRTDIYREGLRSDAAVKSLNDFVNNVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.46
4 0.44
5 0.41
6 0.45
7 0.41
8 0.4
9 0.46
10 0.53
11 0.54
12 0.56
13 0.52
14 0.46
15 0.5
16 0.45
17 0.38
18 0.32
19 0.25
20 0.25
21 0.3
22 0.32
23 0.26
24 0.28
25 0.35
26 0.44
27 0.54
28 0.6
29 0.62
30 0.67
31 0.74
32 0.81
33 0.83
34 0.78
35 0.73
36 0.7
37 0.67
38 0.64
39 0.65
40 0.57
41 0.5
42 0.46
43 0.42
44 0.36
45 0.33
46 0.3
47 0.26
48 0.25
49 0.26
50 0.27
51 0.29
52 0.33
53 0.35
54 0.37
55 0.41
56 0.41
57 0.39
58 0.39
59 0.4
60 0.43
61 0.44
62 0.45
63 0.39
64 0.38
65 0.38
66 0.35
67 0.3
68 0.22
69 0.16
70 0.12
71 0.11
72 0.1
73 0.09
74 0.09
75 0.07
76 0.07
77 0.07
78 0.06
79 0.06
80 0.07
81 0.09
82 0.1
83 0.1
84 0.1
85 0.11
86 0.12
87 0.15
88 0.17
89 0.16
90 0.16
91 0.17
92 0.2
93 0.22
94 0.23
95 0.26
96 0.23
97 0.27
98 0.31
99 0.35
100 0.33
101 0.36
102 0.36
103 0.32
104 0.35
105 0.3
106 0.25
107 0.22
108 0.22
109 0.21
110 0.19
111 0.17
112 0.15
113 0.15
114 0.19
115 0.17
116 0.17
117 0.14
118 0.15
119 0.19
120 0.23
121 0.25
122 0.25
123 0.25
124 0.3
125 0.31
126 0.31
127 0.31
128 0.32
129 0.35
130 0.38
131 0.38
132 0.35
133 0.33
134 0.32
135 0.28
136 0.24
137 0.2
138 0.16
139 0.19
140 0.17
141 0.19
142 0.24
143 0.24
144 0.22
145 0.22