Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2BNE2

Protein Details
Accession A0A0D2BNE2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-48ICQSCRHARLLKRPKRPYTFTQHydrophilic
NLS Segment(s)
PositionSequence
179-187SSGKKGGKK
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSCALRPVLRPGQLPSLPSATTSTTYICQSCRHARLLKRPKRPYTFTQLVTLSDGSAFTMRTTSPTPVYRSTRDTRNSPLWHPTSKELLSVEEDEAGRLAGFRARFGTSFDSAKGAKKGQETTEAQADATVKVNPPSEAKSTKEIKFEDEHNEFEQDDFNILELISSFGQKNPSEEKGSSGKKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.35
4 0.3
5 0.29
6 0.27
7 0.2
8 0.21
9 0.2
10 0.19
11 0.18
12 0.2
13 0.21
14 0.2
15 0.21
16 0.27
17 0.34
18 0.36
19 0.4
20 0.45
21 0.51
22 0.6
23 0.68
24 0.71
25 0.73
26 0.79
27 0.82
28 0.83
29 0.82
30 0.77
31 0.76
32 0.74
33 0.65
34 0.6
35 0.52
36 0.44
37 0.4
38 0.33
39 0.24
40 0.16
41 0.14
42 0.1
43 0.09
44 0.08
45 0.06
46 0.07
47 0.07
48 0.09
49 0.11
50 0.13
51 0.16
52 0.2
53 0.23
54 0.29
55 0.33
56 0.34
57 0.38
58 0.4
59 0.44
60 0.44
61 0.44
62 0.43
63 0.47
64 0.47
65 0.43
66 0.46
67 0.42
68 0.4
69 0.39
70 0.36
71 0.32
72 0.29
73 0.28
74 0.21
75 0.19
76 0.19
77 0.18
78 0.15
79 0.12
80 0.11
81 0.1
82 0.09
83 0.08
84 0.06
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.08
91 0.09
92 0.09
93 0.12
94 0.15
95 0.15
96 0.16
97 0.16
98 0.17
99 0.17
100 0.19
101 0.2
102 0.17
103 0.18
104 0.21
105 0.23
106 0.22
107 0.29
108 0.29
109 0.29
110 0.31
111 0.28
112 0.25
113 0.24
114 0.23
115 0.16
116 0.15
117 0.13
118 0.1
119 0.12
120 0.14
121 0.14
122 0.15
123 0.18
124 0.22
125 0.24
126 0.26
127 0.31
128 0.37
129 0.39
130 0.43
131 0.4
132 0.39
133 0.39
134 0.39
135 0.4
136 0.37
137 0.37
138 0.32
139 0.33
140 0.29
141 0.26
142 0.25
143 0.17
144 0.15
145 0.12
146 0.1
147 0.09
148 0.08
149 0.08
150 0.07
151 0.09
152 0.08
153 0.1
154 0.1
155 0.12
156 0.18
157 0.18
158 0.23
159 0.26
160 0.3
161 0.34
162 0.34
163 0.37
164 0.41
165 0.45
166 0.45
167 0.46