Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZTT1

Protein Details
Accession A0A0D1ZTT1    Localization Confidence High Confidence Score 24.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-55PDGTYRRKTQKIKRDLIQKAKVKHydrophilic
113-139DDQGHSSRNHPRQRRPKQSRFKKELELBasic
159-178KERRAMIKAKKPGKNGKIKLBasic
NLS Segment(s)
PositionSequence
38-57RRKTQKIKRDLIQKAKVKKA
122-179HPRQRRPKQSRFKKELELASQHRANIEAKQRARELRDKERRAMIKAKKPGKNGKIKLG
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MGTKRSSDDRPVGADEPDNKKRKGFSVGPANLPDGTYRRKTQKIKRDLIQKAKVKKAYAKVKAQEEAANPVSSTHIEDEEAHDGPLDAEPASLELHPDRQAMVEAADSRDARDDQGHSSRNHPRQRRPKQSRFKKELELASQHRANIEAKQRARELRDKERRAMIKAKKPGKNGKIKLGRQGTVLLSRIQRMAAEGKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.42
4 0.48
5 0.51
6 0.47
7 0.48
8 0.5
9 0.49
10 0.5
11 0.47
12 0.46
13 0.51
14 0.54
15 0.56
16 0.54
17 0.51
18 0.43
19 0.38
20 0.31
21 0.24
22 0.26
23 0.26
24 0.3
25 0.36
26 0.45
27 0.54
28 0.62
29 0.68
30 0.73
31 0.76
32 0.77
33 0.8
34 0.8
35 0.81
36 0.8
37 0.77
38 0.75
39 0.75
40 0.72
41 0.65
42 0.63
43 0.62
44 0.63
45 0.63
46 0.64
47 0.61
48 0.62
49 0.6
50 0.55
51 0.49
52 0.4
53 0.38
54 0.32
55 0.26
56 0.21
57 0.19
58 0.18
59 0.15
60 0.15
61 0.1
62 0.08
63 0.09
64 0.09
65 0.12
66 0.14
67 0.14
68 0.12
69 0.11
70 0.1
71 0.1
72 0.1
73 0.07
74 0.05
75 0.04
76 0.04
77 0.05
78 0.06
79 0.05
80 0.06
81 0.05
82 0.07
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.09
94 0.09
95 0.09
96 0.11
97 0.1
98 0.1
99 0.11
100 0.12
101 0.13
102 0.19
103 0.23
104 0.23
105 0.29
106 0.37
107 0.44
108 0.51
109 0.55
110 0.6
111 0.67
112 0.77
113 0.82
114 0.84
115 0.86
116 0.89
117 0.93
118 0.93
119 0.9
120 0.84
121 0.8
122 0.76
123 0.71
124 0.65
125 0.62
126 0.55
127 0.54
128 0.5
129 0.43
130 0.36
131 0.33
132 0.28
133 0.26
134 0.31
135 0.33
136 0.33
137 0.38
138 0.41
139 0.44
140 0.49
141 0.51
142 0.5
143 0.53
144 0.61
145 0.62
146 0.63
147 0.68
148 0.66
149 0.63
150 0.65
151 0.64
152 0.63
153 0.68
154 0.72
155 0.7
156 0.74
157 0.79
158 0.79
159 0.81
160 0.76
161 0.77
162 0.78
163 0.75
164 0.77
165 0.74
166 0.65
167 0.56
168 0.54
169 0.47
170 0.42
171 0.4
172 0.35
173 0.3
174 0.3
175 0.29
176 0.26
177 0.23
178 0.2