Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O59835

Protein Details
Accession O59835   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
110-131LGMTRMQRWKRAKNFNLNPPETHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 14, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0005829  C:cytosol  
GO:0043625  C:delta DNA polymerase complex  
GO:0005634  C:nucleus  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0006271  P:DNA strand elongation involved in DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
GO:1904161  P:DNA synthesis involved in UV-damage excision repair  
GO:0006261  P:DNA-templated DNA replication  
GO:1903459  P:mitotic DNA replication lagging strand elongation  
KEGG spo:SPBC12D12.02c  -  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MKKRTTQAKKSGQNTNIRDVFPHVVRSNSSQSHIGKKVSSEQSPTPDVTITTKTLDERIKEDDELSKEVEEAWNQIMAERISEPIHCENITKVEFILHHFDTTARYGPYLGMTRMQRWKRAKNFNLNPPETVGKILMLEEADEENRKRESLFYDLQTIPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.67
4 0.58
5 0.52
6 0.47
7 0.45
8 0.37
9 0.4
10 0.32
11 0.29
12 0.31
13 0.35
14 0.37
15 0.33
16 0.34
17 0.33
18 0.34
19 0.41
20 0.42
21 0.39
22 0.34
23 0.34
24 0.39
25 0.39
26 0.39
27 0.35
28 0.34
29 0.37
30 0.39
31 0.37
32 0.29
33 0.24
34 0.22
35 0.2
36 0.19
37 0.16
38 0.15
39 0.15
40 0.15
41 0.2
42 0.22
43 0.2
44 0.2
45 0.23
46 0.24
47 0.23
48 0.23
49 0.23
50 0.22
51 0.22
52 0.21
53 0.16
54 0.14
55 0.14
56 0.14
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.09
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.11
71 0.1
72 0.12
73 0.11
74 0.11
75 0.11
76 0.15
77 0.15
78 0.13
79 0.11
80 0.12
81 0.12
82 0.14
83 0.18
84 0.14
85 0.14
86 0.14
87 0.14
88 0.15
89 0.16
90 0.17
91 0.12
92 0.11
93 0.12
94 0.12
95 0.15
96 0.15
97 0.14
98 0.17
99 0.18
100 0.24
101 0.33
102 0.35
103 0.41
104 0.46
105 0.56
106 0.6
107 0.7
108 0.72
109 0.75
110 0.8
111 0.81
112 0.83
113 0.76
114 0.67
115 0.6
116 0.54
117 0.43
118 0.36
119 0.27
120 0.17
121 0.16
122 0.15
123 0.12
124 0.09
125 0.09
126 0.08
127 0.1
128 0.11
129 0.15
130 0.15
131 0.18
132 0.19
133 0.19
134 0.18
135 0.2
136 0.22
137 0.26
138 0.31
139 0.31
140 0.36