Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6Y4B8

Protein Details
Accession C6Y4B8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-98DVLRVLKKNIKKRKQAIEQFRKAERHydrophilic
NLS Segment(s)
PositionSequence
81-87KNIKKRK
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003789  Asn/Gln_tRNA_amidoTrase-B-like  
IPR019004  YqeY/Aim41  
IPR042184  YqeY/Aim41_N  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0016884  F:carbon-nitrogen ligase activity, with glutamine as amido-N-donor  
GO:0070900  P:mitochondrial tRNA modification  
Pfam View protein in Pfam  
PF09424  YqeY  
Amino Acid Sequences MYNTYAIIVHVSKLRNSHLFANASAIPNLQAVIRKKLLDSMKSRQKDVASTLKVFLSEIEYANKSSKPVTTDLDVLRVLKKNIKKRKQAIEQFRKAERLDLAEKEESQIQTLRQFLPEHASNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.3
4 0.33
5 0.35
6 0.35
7 0.33
8 0.35
9 0.32
10 0.3
11 0.27
12 0.22
13 0.17
14 0.15
15 0.15
16 0.11
17 0.14
18 0.15
19 0.21
20 0.23
21 0.23
22 0.23
23 0.29
24 0.33
25 0.34
26 0.37
27 0.41
28 0.48
29 0.49
30 0.5
31 0.47
32 0.44
33 0.39
34 0.38
35 0.37
36 0.31
37 0.3
38 0.3
39 0.27
40 0.26
41 0.23
42 0.18
43 0.12
44 0.1
45 0.1
46 0.11
47 0.11
48 0.12
49 0.14
50 0.14
51 0.11
52 0.11
53 0.12
54 0.12
55 0.14
56 0.15
57 0.15
58 0.19
59 0.19
60 0.21
61 0.19
62 0.18
63 0.19
64 0.19
65 0.19
66 0.21
67 0.28
68 0.35
69 0.46
70 0.54
71 0.61
72 0.68
73 0.77
74 0.81
75 0.84
76 0.86
77 0.86
78 0.85
79 0.81
80 0.76
81 0.7
82 0.59
83 0.53
84 0.43
85 0.38
86 0.34
87 0.3
88 0.32
89 0.31
90 0.3
91 0.29
92 0.31
93 0.26
94 0.24
95 0.24
96 0.21
97 0.22
98 0.26
99 0.25
100 0.24
101 0.25
102 0.24
103 0.29