Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2BFP6

Protein Details
Accession A0A0D2BFP6   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-97GEPSTPKARTPRKPKDANATPAHydrophilic
184-206DDKDEKPAKKPRKTPVRKKAAAABasic
NLS Segment(s)
PositionSequence
59-96RKKLSLPKKEKGSGGANGEPSTPKARTPRKPKDANATP
100-100K
155-167AGKKRVRKTKAEK
188-205EKPAKKPRKTPVRKKAAA
219-237PAKAKKATPRKNAAASKKA
Subcellular Location(s) cyto 18.5, cyto_nucl 13.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSEATKKPAPVLTQRETEILIAALQNVKSGDIQIDYANMAVTLGVANGTSAAARWSEVRKKLSLPKKEKGSGGANGEPSTPKARTPRKPKDANATPASTKKTPKTSKTPTHVKDDAEGGDEADELALPATTPKVENNDEEPAVAATPKTPETPAAGKKRVRKTKAEKEAEAAANGGAGADADGDDKDEKPAKKPRKTPVRKKAAAAADAEGDGEVTAAPAKAKKATPRKNAAASKKAAAADAKGSDDADAEVDDADADADADAKDKATKEKLVADAALANDVLNGKKTVTPNLEAGDENVAVGDGASTVDQEEENSDEDEGEDEGEDGRKEADVAEEVNTETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.44
4 0.38
5 0.3
6 0.21
7 0.16
8 0.12
9 0.12
10 0.14
11 0.12
12 0.14
13 0.13
14 0.14
15 0.13
16 0.14
17 0.14
18 0.11
19 0.13
20 0.11
21 0.12
22 0.11
23 0.11
24 0.1
25 0.08
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.1
42 0.17
43 0.25
44 0.32
45 0.36
46 0.37
47 0.43
48 0.53
49 0.59
50 0.62
51 0.63
52 0.65
53 0.7
54 0.72
55 0.68
56 0.64
57 0.6
58 0.55
59 0.52
60 0.47
61 0.4
62 0.36
63 0.35
64 0.3
65 0.27
66 0.26
67 0.21
68 0.21
69 0.29
70 0.38
71 0.47
72 0.57
73 0.66
74 0.71
75 0.79
76 0.8
77 0.82
78 0.81
79 0.79
80 0.73
81 0.66
82 0.59
83 0.55
84 0.55
85 0.48
86 0.45
87 0.42
88 0.48
89 0.51
90 0.55
91 0.6
92 0.65
93 0.7
94 0.73
95 0.78
96 0.71
97 0.72
98 0.69
99 0.59
100 0.51
101 0.44
102 0.36
103 0.28
104 0.25
105 0.16
106 0.13
107 0.11
108 0.09
109 0.07
110 0.06
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.05
119 0.06
120 0.11
121 0.13
122 0.15
123 0.18
124 0.21
125 0.2
126 0.2
127 0.19
128 0.14
129 0.13
130 0.11
131 0.07
132 0.05
133 0.07
134 0.08
135 0.08
136 0.08
137 0.09
138 0.12
139 0.18
140 0.25
141 0.31
142 0.36
143 0.4
144 0.48
145 0.58
146 0.63
147 0.62
148 0.65
149 0.67
150 0.72
151 0.78
152 0.75
153 0.65
154 0.59
155 0.59
156 0.5
157 0.4
158 0.29
159 0.18
160 0.13
161 0.12
162 0.09
163 0.03
164 0.03
165 0.02
166 0.02
167 0.02
168 0.03
169 0.03
170 0.04
171 0.05
172 0.05
173 0.08
174 0.13
175 0.14
176 0.2
177 0.3
178 0.39
179 0.47
180 0.54
181 0.62
182 0.68
183 0.78
184 0.83
185 0.84
186 0.85
187 0.8
188 0.74
189 0.72
190 0.65
191 0.57
192 0.47
193 0.37
194 0.27
195 0.23
196 0.21
197 0.13
198 0.08
199 0.06
200 0.05
201 0.03
202 0.03
203 0.03
204 0.03
205 0.04
206 0.06
207 0.07
208 0.11
209 0.13
210 0.23
211 0.33
212 0.43
213 0.52
214 0.59
215 0.63
216 0.69
217 0.75
218 0.73
219 0.7
220 0.62
221 0.55
222 0.51
223 0.46
224 0.38
225 0.31
226 0.24
227 0.2
228 0.19
229 0.18
230 0.14
231 0.14
232 0.12
233 0.12
234 0.11
235 0.08
236 0.07
237 0.06
238 0.05
239 0.05
240 0.05
241 0.04
242 0.04
243 0.03
244 0.03
245 0.03
246 0.04
247 0.04
248 0.05
249 0.05
250 0.06
251 0.08
252 0.1
253 0.15
254 0.18
255 0.21
256 0.23
257 0.28
258 0.3
259 0.3
260 0.29
261 0.25
262 0.23
263 0.21
264 0.19
265 0.13
266 0.1
267 0.09
268 0.1
269 0.1
270 0.09
271 0.1
272 0.1
273 0.15
274 0.17
275 0.23
276 0.26
277 0.29
278 0.29
279 0.31
280 0.31
281 0.27
282 0.27
283 0.23
284 0.18
285 0.15
286 0.12
287 0.1
288 0.08
289 0.08
290 0.06
291 0.03
292 0.04
293 0.04
294 0.04
295 0.05
296 0.06
297 0.06
298 0.06
299 0.08
300 0.09
301 0.11
302 0.12
303 0.12
304 0.11
305 0.11
306 0.12
307 0.1
308 0.09
309 0.08
310 0.07
311 0.08
312 0.1
313 0.1
314 0.09
315 0.1
316 0.1
317 0.1
318 0.1
319 0.12
320 0.11
321 0.13
322 0.14
323 0.15