Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q10261

Protein Details
Accession Q10261    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MNATQKKKNEKKTKNPYSHNHVNTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
KEGG spo:SPAC56F8.13  -  
Amino Acid Sequences MNATQKKKNEKKTKNPYSHNHVNTKLILPHNTFLTNILFLLGLIKHTNQLTFPSIPHSSAISTLLKQTPLPTRILFLSLCLTPSSASARSSDGIILFPHPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.87
5 0.86
6 0.82
7 0.78
8 0.7
9 0.63
10 0.56
11 0.51
12 0.46
13 0.39
14 0.36
15 0.32
16 0.3
17 0.29
18 0.27
19 0.24
20 0.21
21 0.18
22 0.14
23 0.12
24 0.1
25 0.08
26 0.07
27 0.08
28 0.06
29 0.06
30 0.06
31 0.07
32 0.08
33 0.08
34 0.09
35 0.08
36 0.1
37 0.12
38 0.12
39 0.12
40 0.15
41 0.16
42 0.16
43 0.16
44 0.15
45 0.12
46 0.12
47 0.15
48 0.11
49 0.11
50 0.13
51 0.14
52 0.14
53 0.14
54 0.17
55 0.21
56 0.22
57 0.25
58 0.22
59 0.23
60 0.23
61 0.25
62 0.21
63 0.16
64 0.16
65 0.14
66 0.14
67 0.13
68 0.13
69 0.11
70 0.12
71 0.15
72 0.15
73 0.15
74 0.15
75 0.18
76 0.18
77 0.19
78 0.18
79 0.15
80 0.14
81 0.14