Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P79009

Protein Details
Accession P79009    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPKKKWSKGKVKDKAQHATVHydrophilic
NLS Segment(s)
PositionSequence
4-12KKKWSKGKV
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG spo:SPAC694.05c  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKKKWSKGKVKDKAQHATVFDKSIIDRINKEVPAFKFISVSVLVDRMKINGSLARIAIRDLAERGVIQKVDQHSKQAIYTRVPAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.77
4 0.71
5 0.63
6 0.58
7 0.49
8 0.43
9 0.35
10 0.28
11 0.24
12 0.22
13 0.22
14 0.19
15 0.18
16 0.2
17 0.25
18 0.25
19 0.25
20 0.27
21 0.26
22 0.28
23 0.28
24 0.24
25 0.19
26 0.18
27 0.2
28 0.14
29 0.13
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.1
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.11
45 0.11
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.1
53 0.12
54 0.13
55 0.12
56 0.11
57 0.15
58 0.2
59 0.27
60 0.28
61 0.31
62 0.31
63 0.33
64 0.37
65 0.38
66 0.37
67 0.33
68 0.37
69 0.36